Recombinant Human IRF1 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | IRF1-314H |
Product Overview : | IRF1 MS Standard C13 and N15-labeled recombinant protein (NP_002189) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a transcriptional regulator and tumor suppressor, serving as an activator of genes involved in both innate and acquired immune responses. The encoded protein activates the transcription of genes involved in the body's response to viruses and bacteria, playing a role in cell proliferation, apoptosis, the immune response, and DNA damage response. This protein represses the transcription of several other genes. As a tumor suppressor, it both suppresses tumor cell growth and stimulates an immune response against tumor cells. Defects in this gene have been associated with gastric cancer, myelogenous leukemia, and lung cancer. [provided by RefSeq, Aug 2017] |
Molecular Mass : | 36.5 kDa |
AA Sequence : | MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IRF1 interferon regulatory factor 1 [ Homo sapiens (human) ] |
Official Symbol | IRF1 |
Synonyms | IRF1; interferon regulatory factor 1; MAR; IRF-1; |
Gene ID | 3659 |
mRNA Refseq | NM_002198 |
Protein Refseq | NP_002189 |
MIM | 147575 |
UniProt ID | P10914 |
◆ Recombinant Proteins | ||
IRF1-29246TH | Recombinant Human IRF1, His-tagged | +Inquiry |
IRF1-3096R | Recombinant Rat IRF1 Protein | +Inquiry |
IRF1-5046H | Recombinant Human IRF1 Protein, GST-tagged | +Inquiry |
IRF1-243H | Recombinant Human IRF1 | +Inquiry |
IRF1-7512HFL | Recombinant Full Length Human IRF1 protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF1-5168HCL | Recombinant Human IRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF1 Products
Required fields are marked with *
My Review for All IRF1 Products
Required fields are marked with *
0
Inquiry Basket