Recombinant Human IRF3 Protein, GST-tagged
Cat.No. : | IRF3-5041H |
Product Overview : | Human IRF3 full-length ORF ( AAH09395, 1 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | IRF3 encodes interferon regulatory factor 3, a member of the interferon regulatory transcription factor (IRF) family. IRF3 is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes. [provided by RefSeq |
Molecular Mass : | 75.24 kDa |
AA Sequence : | MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALSRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKGKEGGVFDLGPFIVGSWAPRSDYLHGRKRTLTTLCPLVLCGGVMAPGPAVDQEARDGQGCAHVPQGLGRNGPGRGCLLPGEYCGPAHFQQPPTLPHLRPVQGLPAGLGGGHGFPGPWGDLSPRSSWCASNPPVPHHLNQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IRF3 interferon regulatory factor 3 [ Homo sapiens ] |
Official Symbol | IRF3 |
Synonyms | IRF3; interferon regulatory factor 3; |
Gene ID | 3661 |
mRNA Refseq | NM_001197128 |
Protein Refseq | NP_001184057 |
MIM | 603734 |
UniProt ID | Q14653 |
◆ Recombinant Proteins | ||
IRF3-072H | Recombinant Human IRF3 Protein, His-tagged | +Inquiry |
IRF3-27H | Recombinant Human Interferon Regulatory Factor 3 | +Inquiry |
IRF3-60H | Recombinant Human IRF3 protein, His-tagged | +Inquiry |
IRF3-5738HF | Recombinant Full Length Human IRF3 Protein, GST-tagged | +Inquiry |
IRF3-1196H | Recombinant Human IRF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF3-5166HCL | Recombinant Human IRF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF3 Products
Required fields are marked with *
My Review for All IRF3 Products
Required fields are marked with *