Recombinant Human IRF4 protein, T7/His-tagged

Cat.No. : IRF4-105H
Product Overview : Recombinant human IRF4 (450 aa, derived from BC015752) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEK SIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPY KVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMT FGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPE GCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRP NKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSG HFLRGYDLPEHISNPEDYHRSIRHSSIQE
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro IRF4 mediated gene transcription regulation for brown fat cell and macrophage interferon pathway study with "ProFectin" reagent based intracellular delivery of this protein.2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for IRF4 protein-protein interaction mapping.4. As immunogen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name IRF4 interferon regulatory factor 4 [ Homo sapiens ]
Official Symbol IRF4
Synonyms IRF4; interferon regulatory factor 4; MUM1; LSIRF; multiple myeloma oncogene 1; lymphocyte-specific interferon regulatory factor; NF-EM5;
Gene ID 3662
mRNA Refseq NM_001195286
Protein Refseq NP_001182215
MIM 601900
UniProt ID Q15306
Chromosome Location 6p25-p23
Pathway Apoptosis, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; IL4-mediated signaling events, organism-specific biosystem; Immune System, organism-specific biosystem
Function regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IRF4 Products

Required fields are marked with *

My Review for All IRF4 Products

Required fields are marked with *

0
cart-icon
0
compare icon