Recombinant Human IRF4 protein, T7/His-tagged
| Cat.No. : | IRF4-105H | 
| Product Overview : | Recombinant human IRF4 (450 aa, derived from BC015752) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&T7 | 
| Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. | 
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEK SIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPY KVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMT FGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPE GCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRP NKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSG HFLRGYDLPEHISNPEDYHRSIRHSSIQE | 
| Purity : | >90% by SDS-PAGE | 
| Applications : | 1. May be used for in vitro IRF4 mediated gene transcription regulation for brown fat cell and macrophage interferon pathway study with "ProFectin" reagent based intracellular delivery of this protein.2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for IRF4 protein-protein interaction mapping.4. As immunogen for specific antibody production. | 
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. | 
| Gene Name | IRF4 interferon regulatory factor 4 [ Homo sapiens ] | 
| Official Symbol | IRF4 | 
| Synonyms | IRF4; interferon regulatory factor 4; MUM1; LSIRF; multiple myeloma oncogene 1; lymphocyte-specific interferon regulatory factor; NF-EM5; | 
| Gene ID | 3662 | 
| mRNA Refseq | NM_001195286 | 
| Protein Refseq | NP_001182215 | 
| MIM | 601900 | 
| UniProt ID | Q15306 | 
| Chromosome Location | 6p25-p23 | 
| Pathway | Apoptosis, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; IL4-mediated signaling events, organism-specific biosystem; Immune System, organism-specific biosystem | 
| Function | regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; | 
| ◆ Recombinant Proteins | ||
| IRF4-1197H | Recombinant Human IRF4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| IRF4-5039H | Recombinant Human IRF4 Protein, GST-tagged | +Inquiry | 
| IRF4-726H | Recombinant Human IRF4 Protein, GST-His-tagged | +Inquiry | 
| IRF4-5739HF | Recombinant Full Length Human IRF4 Protein, GST-tagged | +Inquiry | 
| IRF4-3565H | Recombinant Human IRF4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| IRF4-5165HCL | Recombinant Human IRF4 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All IRF4 Products
Required fields are marked with *
My Review for All IRF4 Products
Required fields are marked with *
  
        
    
      
            