"IRF4" Related Products

Expand
Expand
Expand

Recombinant Human IRF4 protein, T7/His-tagged

Cat.No.: IRF4-105H
Product Overview: Recombinant human IRF4 (450 aa, derived from BC015752) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEK SIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPY KVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMT FGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPE GCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRP NKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSG HFLRGYDLPEHISNPEDYHRSIRHSSIQE
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro IRF4 mediated gene transcription regulation for brown fat cell and macrophage interferon pathway study with "ProFectin" reagent based intracellular delivery of this protein.2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for IRF4 protein-protein interaction mapping.4. As immunogen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: IRF4 interferon regulatory factor 4 [ Homo sapiens ]
Official Symbol: IRF4
Synonyms: IRF4; interferon regulatory factor 4; MUM1; LSIRF; multiple myeloma oncogene 1; lymphocyte-specific interferon regulatory factor; NF-EM5;
Gene ID: 3662
mRNA Refseq: NM_001195286
Protein Refseq: NP_001182215
MIM: 601900
UniProt ID: Q15306
Chromosome Location: 6p25-p23
Pathway: Apoptosis, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; IL4-mediated signaling events, organism-specific biosystem; Immune System, organism-specific biosystem
Function: regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.