Recombinant Human IRF4 protein, T7/His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human IRF4 protein, T7/His-tagged

Recombinant Human IRF4 protein, T7/His-tagged

IRF4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IRF4-105H
Product Overview : Recombinant human IRF4 (450 aa, derived from BC015752) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7/His
Form : 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEK SIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPY KVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMT FGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPE GCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRP NKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSG HFLRGYDLPEHISNPEDYHRSIRHSSIQE
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro IRF4 mediated gene transcription regulation for brown fat cell and macrophage interferon pathway study with "ProFectin" reagent based intracellular delivery of this protein.2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for IRF4 protein-protein interaction mapping.4. As immunogen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name : IRF4 interferon regulatory factor 4 [ Homo sapiens ]
Official Symbol : IRF4
Synonyms : IRF4; interferon regulatory factor 4; MUM1; LSIRF; multiple myeloma oncogene 1; lymphocyte-specific interferon regulatory factor; NF-EM5;
Gene ID : 3662
mRNA Refseq : NM_001195286
Protein Refseq : NP_001182215
MIM : 601900
UniProt ID : Q15306
Chromosome Location : 6p25-p23
Pathway : Apoptosis, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; IL4-mediated signaling events, organism-specific biosystem; Immune System, organism-specific biosystem
Function : regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.