Recombinant Human IRF5 protein(71-170 aa), C-His-tagged
Cat.No. : | IRF5-2856H |
Product Overview : | Recombinant Human IRF5 protein(Q13568)(71-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 71-170 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQ |
Gene Name | IRF5 interferon regulatory factor 5 [ Homo sapiens ] |
Official Symbol | IRF5 |
Synonyms | IRF5; interferon regulatory factor 5; IRF-5; SLEB10; |
Gene ID | 3663 |
mRNA Refseq | NM_001098627 |
Protein Refseq | NP_001092097 |
MIM | 607218 |
UniProt ID | Q13568 |
◆ Recombinant Proteins | ||
IRF5-5740HF | Recombinant Full Length Human IRF5 Protein, GST-tagged | +Inquiry |
IRF5-007H | Recombinant Human IRF5 Protein, Myc/DDK-tagged | +Inquiry |
IRF5-5121H | Recombinant Human IRF5, His-tagged | +Inquiry |
IRF5-010H | Recombinant Human IRF5 Protein, His-tagged | +Inquiry |
IRF5-011H | Recombinant Human IRF5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF5-5163HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
IRF5-5162HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
IRF5-5164HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF5 Products
Required fields are marked with *
My Review for All IRF5 Products
Required fields are marked with *
0
Inquiry Basket