Recombinant Human IRF5 protein(71-170 aa), C-His-tagged
| Cat.No. : | IRF5-2856H |
| Product Overview : | Recombinant Human IRF5 protein(Q13568)(71-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 71-170 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQ |
| Gene Name | IRF5 interferon regulatory factor 5 [ Homo sapiens ] |
| Official Symbol | IRF5 |
| Synonyms | IRF5; interferon regulatory factor 5; IRF-5; SLEB10; |
| Gene ID | 3663 |
| mRNA Refseq | NM_001098627 |
| Protein Refseq | NP_001092097 |
| MIM | 607218 |
| UniProt ID | Q13568 |
| ◆ Recombinant Proteins | ||
| IRF5-1198H | Recombinant Human IRF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IRF5-8303M | Recombinant Mouse IRF5 Protein | +Inquiry |
| IRF5-2228H | Recombinant Human IRF5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IRF5-5121H | Recombinant Human IRF5, His-tagged | +Inquiry |
| Irf5-3576M | Recombinant Mouse Irf5 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRF5-5163HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
| IRF5-5162HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
| IRF5-5164HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF5 Products
Required fields are marked with *
My Review for All IRF5 Products
Required fields are marked with *
