Recombinant Human IRF5 protein(71-170 aa), C-His-tagged

• Cat.No.: IRF5-2856H
• Product Overview: Recombinant Human IRF5 protein(Q13568)(71-170 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 71-170 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQ

Gene Information

• Gene Name: IRF5 interferon regulatory factor 5 [ Homo sapiens ]
• Official Symbol: IRF5
• Synonyms: IRF5; interferon regulatory factor 5; IRF-5; SLEB10
• Gene ID: 3663
• mRNA Refseq: NM_001098627
• Protein Refseq: NP_001092097
• MIM: 607218
• UniProt ID: Q13568