Recombinant Human IRF5 protein(71-170 aa), C-His-tagged

Cat.No. : IRF5-2856H
Product Overview : Recombinant Human IRF5 protein(Q13568)(71-170 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 71-170 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQ
Gene Name IRF5 interferon regulatory factor 5 [ Homo sapiens ]
Official Symbol IRF5
Synonyms IRF5; interferon regulatory factor 5; IRF-5; SLEB10;
Gene ID 3663
mRNA Refseq NM_001098627
Protein Refseq NP_001092097
MIM 607218
UniProt ID Q13568

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IRF5 Products

Required fields are marked with *

My Review for All IRF5 Products

Required fields are marked with *

0
cart-icon
0
compare icon