Recombinant Human IRF5 protein, His-tagged
Cat.No. : | IRF5-011H |
Product Overview : | Recombinant Human IRF5 protein(172-498 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 172-498 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AASequence : | PTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | IRF5 interferon regulatory factor 5 [ Homo sapiens ] |
Official Symbol | IRF5 |
Synonyms | IRF5; interferon regulatory factor 5; IRF-5; SLEB10; |
Gene ID | 3663 |
mRNA Refseq | NM_001098627 |
Protein Refseq | NP_001092097 |
MIM | 607218 |
UniProt ID | Q13568 |
◆ Recombinant Proteins | ||
IRF5-591H | Recombinant Human IRF5 protein, Myc/DDK-tagged | +Inquiry |
IRF5-3997H | Recombinant Human IRF5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IRF5-590H | Recombinant Human IRF5 protein, Myc/DDK-tagged | +Inquiry |
IRF5-5037H | Recombinant Human IRF5 Protein, GST-tagged | +Inquiry |
IRF5-589H | Recombinant Human IRF5 protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF5-5164HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
IRF5-5163HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
IRF5-5162HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF5 Products
Required fields are marked with *
My Review for All IRF5 Products
Required fields are marked with *