Recombinant Human IRF5 protein, His-tagged
| Cat.No. : | IRF5-011H |
| Product Overview : | Recombinant Human IRF5 protein(172-498 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 172-498 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | PTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | IRF5 interferon regulatory factor 5 [ Homo sapiens ] |
| Official Symbol | IRF5 |
| Synonyms | IRF5; interferon regulatory factor 5; IRF-5; SLEB10; |
| Gene ID | 3663 |
| mRNA Refseq | NM_001098627 |
| Protein Refseq | NP_001092097 |
| MIM | 607218 |
| UniProt ID | Q13568 |
| ◆ Recombinant Proteins | ||
| IRF5-005H | Recombinant Human IRF5 Protein, Myc/DDK-tagged | +Inquiry |
| IRF5-011H | Recombinant Human IRF5 protein, His-tagged | +Inquiry |
| Irf5-3576M | Recombinant Mouse Irf5 Protein, Myc/DDK-tagged | +Inquiry |
| IRF5-593H | Recombinant Human IRF5 protein, His-tagged | +Inquiry |
| IRF5-588H | Recombinant Human IRF5 protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRF5-5163HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
| IRF5-5162HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
| IRF5-5164HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF5 Products
Required fields are marked with *
My Review for All IRF5 Products
Required fields are marked with *
