Recombinant Human IRF6
| Cat.No. : | IRF6-28727TH |
| Product Overview : | Recombinant fragment of Human IRF6 with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. The encoded protein may be a transcriptional activator. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. Mutations in this gene are also associated with non-syndromic orofacial cleft type 6. Alternate splicing results in multiple transcript variants. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Expressed in normal mammary epithelial cells. Expression is reduced or absent in breast carcinomas. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ |
| Sequence Similarities : | Belongs to the IRF family.Contains 1 IRF tryptophan pentad repeat DNA-binding domain. |
| Gene Name | IRF6 interferon regulatory factor 6 [ Homo sapiens ] |
| Official Symbol | IRF6 |
| Synonyms | IRF6; interferon regulatory factor 6; LPS, Van der Woude syndrome , VWS; OFC6; VWS1; |
| Gene ID | 3664 |
| mRNA Refseq | NM_001206696 |
| Protein Refseq | NP_001193625 |
| MIM | 607199 |
| Uniprot ID | O14896 |
| Chromosome Location | 1q32.2-q32.3 |
| Pathway | Apoptosis, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; Interferon alpha/beta signaling, organism-specific biosystem; |
| Function | DNA binding; protein binding; regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| IRF6-2120R | Recombinant Rhesus Macaque IRF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IRF6-2921H | Recombinant Human IRF6 Protein (Glu196-Thr445), N-His tagged | +Inquiry |
| IRF6-2299R | Recombinant Rhesus monkey IRF6 Protein, His-tagged | +Inquiry |
| IRF6-528HFL | Recombinant Full Length Human IRF6 Protein, C-Flag-tagged | +Inquiry |
| IRF6-1199H | Recombinant Human IRF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRF6-5161HCL | Recombinant Human IRF6 293 Cell Lysate | +Inquiry |
| IRF6-212HKCL | Human IRF6 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF6 Products
Required fields are marked with *
My Review for All IRF6 Products
Required fields are marked with *
