Recombinant Human IRF8 Protein, GST-tagged
| Cat.No. : | IRF8-5033H |
| Product Overview : | Human IRF8 full-length ORF ( NP_002154.1, 1 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Interferon consensus sequence-binding protein (ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. [provided by RefSeq |
| Molecular Mass : | 74.8 kDa |
| AA Sequence : | MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | IRF8 interferon regulatory factor 8 [ Homo sapiens ] |
| Official Symbol | IRF8 |
| Synonyms | IRF8; interferon regulatory factor 8; ICSBP1, interferon consensus sequence binding protein 1; ICSBP; IRF 8; interferon consensus sequence binding protein 1; IRF-8; ICSBP1; H-ICSBP; |
| Gene ID | 3394 |
| mRNA Refseq | NM_002163 |
| Protein Refseq | NP_002154 |
| MIM | 601565 |
| UniProt ID | Q02556 |
| ◆ Recombinant Proteins | ||
| IRF8-4899H | Recombinant Human IRF8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IRF8-6967C | Recombinant Chicken IRF8 | +Inquiry |
| IRF8-8306M | Recombinant Mouse IRF8 Protein | +Inquiry |
| IRF8-156H | Recombinant Human IRF8, His-tagged | +Inquiry |
| Irf8-1206M | Recombinant Mouse Irf8 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRF8-5159HCL | Recombinant Human IRF8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF8 Products
Required fields are marked with *
My Review for All IRF8 Products
Required fields are marked with *
