Recombinant Human IRF9 Protein, GST-tagged

Cat.No. : IRF9-5016H
Product Overview : Human ISGF3G full-length ORF ( AAH35716, 1 a.a. - 393 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : IRF9 (Interferon Regulatory Factor 9) is a Protein Coding gene. Diseases associated with IRF9 include Skin Papilloma and Hepatitis C. Among its related pathways are Type I Interferon Signaling Pathways and Immune response IFN alpha/beta signaling pathway. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and regulatory region DNA binding. An important paralog of this gene is IRF4.
Molecular Mass : 68.97 kDa
AA Sequence : MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IRF9 interferon regulatory factor 9 [ Homo sapiens ]
Official Symbol IRF9
Synonyms IRF9; interferon regulatory factor 9; interferon stimulated transcription factor 3, gamma (48kD) , interferon stimulated transcription factor 3, gamma 48kDa , ISGF3G; ISGF-3 gamma; ISGF3 p48 subunit; interferon-stimulated gene factor 3 gamma; transcriptional regulator ISGF3 subunit gamma; IFN-alpha-responsive transcription factor subunit; interferon-stimulated transcription factor 3, gamma 48kDa; interferon-stimulated transcription factor 3, gamma (48kD); p48; IRF-9; ISGF3; ISGF3G;
Gene ID 10379
mRNA Refseq NM_006084
Protein Refseq NP_006075
MIM 147574
UniProt ID Q00978

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IRF9 Products

Required fields are marked with *

My Review for All IRF9 Products

Required fields are marked with *

0
cart-icon