Recombinant Human IRX4 Protein, His-tagged
| Cat.No. : | IRX4-42H |
| Product Overview : | Recombinant Human IRX4 Protein(231-430 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 231-430 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 22 kDa |
| AASequence : | EEEAREEPLKSSKNAEPVGKEEKELELSDLDDFDPLEAEPPACELKPPFHSLDGGLERVPAAPDGPVKEASGALRMSLAAGGGAALDEDLERARSCLRSAAAGPEPLPGAEGGPQVCEAKLGFVPAGASAGLEAKPRIWSLAHTATAAAAAATSLSQTEFPSCMLKRQGPAAPAAVSSAPATSPSVALPHSGALDRHQDS |
| Storage : | Store at -20°C to -80°C. |
| Concentration : | 0.1-1.0 mg/ml |
| ◆ Recombinant Proteins | ||
| IRX4-782H | Recombinant Human IRX4 | +Inquiry |
| IRX4-43H | Recombinant Human IRX4 Protein, His&GST-tagged | +Inquiry |
| IRX4-1140C | Recombinant Chicken IRX4 | +Inquiry |
| IRX4-42H | Recombinant Human IRX4 Protein, His-tagged | +Inquiry |
| IRX4-41H | Recombinant Human IRX4 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRX4-5156HCL | Recombinant Human IRX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRX4 Products
Required fields are marked with *
My Review for All IRX4 Products
Required fields are marked with *
