Recombinant Human ISG15 Protein, His-tagged
| Cat.No. : | ISG15-551H |
| Product Overview : | Recombinant Human ISG15 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-165 aa |
| Description : | The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. |
| Form : | Supplied as a 0.2 µM filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0 |
| Molecular Mass : | 18.2kD |
| AA Sequence : | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGLEHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | ISG15 ISG15 ubiquitin-like modifier [ Homo sapiens ] |
| Official Symbol | ISG15 |
| Synonyms | ISG15; ISG15 ubiquitin-like modifier; G1P2, interferon, alpha inducible protein (clone IFI 15K); ubiquitin-like protein ISG15; IFI15; UCRP; ubiquitin cross-reactive protein; interferon-induced 15 kDa protein; interferon-induced 17 kDa protein; interferon-stimulated protein, 15 kDa; interferon-induced 17-kDa/15-kDa protein; interferon, alpha-inducible protein (clone IFI-15K); G1P2; IP17; hUCRP; |
| Gene ID | 9636 |
| mRNA Refseq | NM_005101 |
| Protein Refseq | NP_005092 |
| MIM | 147571 |
| UniProt ID | P05161 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISG15 Products
Required fields are marked with *
My Review for All ISG15 Products
Required fields are marked with *



