Recombinant Human ISG15 protein, His-tagged
| Cat.No. : | ISG15-3422H |
| Product Overview : | Recombinant Human ISG15 protein(1-165 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 20, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-165 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ISG15 ISG15 ubiquitin-like modifier [ Homo sapiens ] |
| Official Symbol | ISG15 |
| Synonyms | ISG15; ISG15 ubiquitin-like modifier; G1P2, interferon, alpha inducible protein (clone IFI 15K); ubiquitin-like protein ISG15; IFI15; UCRP; ubiquitin cross-reactive protein; interferon-induced 15 kDa protein; interferon-induced 17 kDa protein; interferon-stimulated protein, 15 kDa; interferon-induced 17-kDa/15-kDa protein; interferon, alpha-inducible protein (clone IFI-15K); G1P2; IP17; hUCRP; |
| Gene ID | 9636 |
| mRNA Refseq | NM_005101 |
| Protein Refseq | NP_005092 |
| MIM | 147571 |
| UniProt ID | P05161 |
| ◆ Recombinant Proteins | ||
| Isg15-83H | Recombinant Human Isg15 protein | +Inquiry |
| ISG15-2606H | Recombinant Human ISG15 protein | +Inquiry |
| ISG15-4331M | Recombinant Mouse ISG15 protein(1-155aa), His&Myc-tagged | +Inquiry |
| Isg15-40M | Recombinant Mouse Isg15 Protein, His-tagged | +Inquiry |
| ISG15-4333H | Recombinant Human ISG15 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ISG15-5152HCL | Recombinant Human ISG15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISG15 Products
Required fields are marked with *
My Review for All ISG15 Products
Required fields are marked with *
