Recombinant Human ITGA2 protein(711-790 aa), C-His-tagged
| Cat.No. : | ITGA2-2671H |
| Product Overview : | Recombinant Human ITGA2 protein(P17301)(711-790 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 711-790 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | VTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCG |
| Gene Name | ITGA2 integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) [ Homo sapiens ] |
| Official Symbol | ITGA2 |
| Synonyms | ITGA2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); CD49B; integrin alpha-2; CD49b; integrin alpha 2; collagen receptor; VLA-2 subunit alpha; platelet antigen Br; platelet glycoprotein Ia; platelet glycoprotein GPIa; CD49 antigen-like family member B; platelet membrane glycoprotein Ia; very late activation protein 2 receptor, alpha-2 subunit; BR; GPIa; VLA-2; VLAA2; BDPLT9; |
| Gene ID | 3673 |
| mRNA Refseq | NM_002203 |
| Protein Refseq | NP_002194 |
| MIM | 192974 |
| UniProt ID | P17301 |
| ◆ Recombinant Proteins | ||
| Itga2-5837M | Recombinant Mouse Itga2 protein, His & GST-tagged | +Inquiry |
| ITGA2-2313R | Recombinant Rhesus monkey ITGA2 Protein, His-tagged | +Inquiry |
| ITGA2-5835C | Recombinant Cattle ITGA2 protein, His-tagged | +Inquiry |
| ITGA2-5838M | Recombinant Monkey ITGA2 (Met1-Pro908) and ITGB3 (Met1-Pro717) Protein, C-His and C-Strep tagged | +Inquiry |
| ITGA2-4634M | Recombinant Mouse ITGA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGA2-5135HCL | Recombinant Human ITGA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA2 Products
Required fields are marked with *
My Review for All ITGA2 Products
Required fields are marked with *



