Recombinant Human ITGA2 protein(711-790 aa), C-His-tagged
Cat.No. : | ITGA2-2671H |
Product Overview : | Recombinant Human ITGA2 protein(P17301)(711-790 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 711-790 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | VTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCG |
Gene Name | ITGA2 integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) [ Homo sapiens ] |
Official Symbol | ITGA2 |
Synonyms | ITGA2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); CD49B; integrin alpha-2; CD49b; integrin alpha 2; collagen receptor; VLA-2 subunit alpha; platelet antigen Br; platelet glycoprotein Ia; platelet glycoprotein GPIa; CD49 antigen-like family member B; platelet membrane glycoprotein Ia; very late activation protein 2 receptor, alpha-2 subunit; BR; GPIa; VLA-2; VLAA2; BDPLT9; |
Gene ID | 3673 |
mRNA Refseq | NM_002203 |
Protein Refseq | NP_002194 |
MIM | 192974 |
UniProt ID | P17301 |
◆ Recombinant Proteins | ||
ITGA2-4317H | Recombinant Human ITGA2 Protein (Met1-Thr1132), C-His tagged | +Inquiry |
ITGA2-3123H | Recombinant Human ITGA2 protein, His-SUMO-tagged | +Inquiry |
ITGA2-2313R | Recombinant Rhesus monkey ITGA2 Protein, His-tagged | +Inquiry |
Itga2-5837M | Recombinant Mouse Itga2 protein, His & GST-tagged | +Inquiry |
ITGA2-5836H | Recombinant Human ITGA2 protein, His & S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA2-5135HCL | Recombinant Human ITGA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA2 Products
Required fields are marked with *
My Review for All ITGA2 Products
Required fields are marked with *