Recombinant Human ITGA2B Protein, GST-tagged
Cat.No. : | ITGA2B-4999H |
Product Overview : | Human ITGA2B partial ORF (NP_000410.2, 504 a.a. - 602 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 504-602 a.a. |
Description : | ITGA2B encodes integrin alpha chain 2b. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibronectin receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | CVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) [ Homo sapiens ] |
Official Symbol | ITGA2B |
Synonyms | ITGA2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); GP2B, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41B); integrin alpha-IIb; CD41; CD41B; GPalpha IIb; platelet-specific antigen BAK; platelet membrane glycoprotein IIb; platelet fibrinogen receptor, alpha subunit; GT; GTA; GP2B; HPA3; GPIIb; BDPLT2; |
Gene ID | 3674 |
mRNA Refseq | NM_000419 |
Protein Refseq | NP_000410 |
MIM | 607759 |
UniProt ID | P08514 |
◆ Recombinant Proteins | ||
ITGA2B-1586H | Recombinant Human ITGA2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Itga2b-3593M | Recombinant Mouse Itga2b Protein, Myc/DDK-tagged | +Inquiry |
ITGA2B-2615H | Recombinant Human ITGA2B Protein, MYC/DDK-tagged | +Inquiry |
ITGA2B-1425H | Recombinant Human ITGA2B Protein (639-887 aa), His-tagged | +Inquiry |
ITGA2B-0948H | Recombinant Human ITGA2B Protein (Ala678-Leu894), N-His tagged | +Inquiry |
◆ Native Proteins | ||
ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA2B Products
Required fields are marked with *
My Review for All ITGA2B Products
Required fields are marked with *