Recombinant Human ITGA6, GST-tagged
Cat.No. : | ITGA6-4111H |
Product Overview : | Recombinant Human ITGA6 (24 a.a. - 133 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 24 a.a. - 133 a.a. |
Description : | The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIE FDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAH |
Purification : | Glutathione Sepharose 4 Fast Flow |
Applications : | ELISA; WB; Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGA6 integrin, alpha 6 [ Homo sapiens (human) ] |
Official Symbol | ITGA6 |
Synonyms | ITGA6; integrin, alpha 6; CD49f; VLA-6; ITGA6B; integrin alpha-6; integrin alpha6B; CD49 antigen-like family member F |
Gene ID | 3655 |
mRNA Refseq | NM_000210 |
Protein Refseq | NP_000201 |
MIM | 147556 |
UniProt ID | P23229 |
Chromosome Location | 2q31.1 |
Pathway | Alpha6-Beta4 Integrin Signaling Pathway; Arf6 trafficking events; Arrhythmogenic right ventricular cardiomyopathy; Assembly of collagen fibrils and other multimeric structures |
Function | metal ion binding; protein binding |
◆ Recombinant Proteins | ||
Itga6-3597M | Recombinant Mouse Itga6 Protein, Myc/DDK-tagged | +Inquiry |
ITGA6-6841C | Recombinant Chicken ITGA6 | +Inquiry |
ITGA6-4110H | Active Recombinant Human ITGA6 | +Inquiry |
ITGA6-4115H | Recombinant Human ITGA6, flag & His tagged | +Inquiry |
ITGA6-2135R | Recombinant Rhesus Macaque ITGA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA6-5131HCL | Recombinant Human ITGA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA6 Products
Required fields are marked with *
My Review for All ITGA6 Products
Required fields are marked with *