Recombinant Human ITGA6, GST-tagged
| Cat.No. : | ITGA6-4111H |
| Product Overview : | Recombinant Human ITGA6 (24 a.a. - 133 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 24 a.a. - 133 a.a. |
| Description : | The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIE FDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAH |
| Purification : | Glutathione Sepharose 4 Fast Flow |
| Applications : | ELISA; WB; Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ITGA6 integrin, alpha 6 [ Homo sapiens (human) ] |
| Official Symbol | ITGA6 |
| Synonyms | ITGA6; integrin, alpha 6; CD49f; VLA-6; ITGA6B; integrin alpha-6; integrin alpha6B; CD49 antigen-like family member F |
| Gene ID | 3655 |
| mRNA Refseq | NM_000210 |
| Protein Refseq | NP_000201 |
| MIM | 147556 |
| UniProt ID | P23229 |
| Chromosome Location | 2q31.1 |
| Pathway | Alpha6-Beta4 Integrin Signaling Pathway; Arf6 trafficking events; Arrhythmogenic right ventricular cardiomyopathy; Assembly of collagen fibrils and other multimeric structures |
| Function | metal ion binding; protein binding |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA6 Products
Required fields are marked with *
My Review for All ITGA6 Products
Required fields are marked with *
