Recombinant Human ITGA6 protein(621-730 aa), C-His-tagged
Cat.No. : | ITGA6-2700H |
Product Overview : | Recombinant Human ITGA6 protein(P23229)(621-730 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 621-730 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | ITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKD |
Gene Name | ITGA6 integrin, alpha 6 [ Homo sapiens ] |
Official Symbol | ITGA6 |
Synonyms | ITGA6; integrin, alpha 6; integrin alpha-6; CD49f; integrin alpha6B; CD49 antigen-like family member F; VLA-6; ITGA6B; FLJ18737; DKFZp686J01244; |
Gene ID | 3655 |
mRNA Refseq | NM_000210 |
Protein Refseq | NP_000201 |
MIM | 147556 |
UniProt ID | P23229 |
◆ Recombinant Proteins | ||
ITGA6-3016H | Recombinant Human ITGA6 protein, His-tagged | +Inquiry |
ITGA6-5725HF | Recombinant Full Length Human ITGA6 Protein | +Inquiry |
ITGA6-4315H | Recombinant Human ITGA6 Protein (Met1-Arg938), C-His tagged | +Inquiry |
Itga6-6767M | Recombinant Mouse Itga6 protein, His & GST-tagged | +Inquiry |
Itga6-1698M | Recombinant Mouse Itga6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA6-5131HCL | Recombinant Human ITGA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGA6 Products
Required fields are marked with *
My Review for All ITGA6 Products
Required fields are marked with *
0
Inquiry Basket