Recombinant Human ITGA6 protein(621-730 aa), C-His-tagged
| Cat.No. : | ITGA6-2700H |
| Product Overview : | Recombinant Human ITGA6 protein(P23229)(621-730 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 621-730 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | ITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKD |
| Gene Name | ITGA6 integrin, alpha 6 [ Homo sapiens ] |
| Official Symbol | ITGA6 |
| Synonyms | ITGA6; integrin, alpha 6; integrin alpha-6; CD49f; integrin alpha6B; CD49 antigen-like family member F; VLA-6; ITGA6B; FLJ18737; DKFZp686J01244; |
| Gene ID | 3655 |
| mRNA Refseq | NM_000210 |
| Protein Refseq | NP_000201 |
| MIM | 147556 |
| UniProt ID | P23229 |
| ◆ Recombinant Proteins | ||
| ITGA6-2135R | Recombinant Rhesus Macaque ITGA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ITGA6-2314R | Recombinant Rhesus monkey ITGA6 Protein, His-tagged | +Inquiry |
| ITGA6-4115H | Recombinant Human ITGA6, flag & His tagged | +Inquiry |
| Itga6-1698M | Recombinant Mouse Itga6 Protein, His-tagged | +Inquiry |
| ITGA6-1218H | Recombinant Human ITGA6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGA6-5131HCL | Recombinant Human ITGA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA6 Products
Required fields are marked with *
My Review for All ITGA6 Products
Required fields are marked with *



