Recombinant Human ITGA8 Protein, GST-tagged
Cat.No. : | ITGA8-4993H |
Product Overview : | Human ITGA8 partial ORF ( NP_003629, 836 a.a. - 935 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Integrins are heterodimeric transmembrane receptor proteins that mediate numerous cellular processes including cell adhesion, cytoskeletal rearrangement, and activation of cell signaling pathways. Integrins are composed of alpha and beta subunits. This gene encodes the alpha 8 subunit of the heterodimeric integrin alpha8beta1 protein. The encoded protein is a single-pass type 1 membrane protein that contains multiple FG-GAP repeats. This repeat is predicted to fold into a beta propeller structure. This gene regulates the recruitment of mesenchymal cells into epithelial structures, mediates cell-cell interactions, and regulates neurite outgrowth of sensory and motor neurons. The integrin alpha8beta1 protein thus plays an important role in wound-healing and organogenesis. Mutations in this gene have been associated with renal hypodysplasia/aplasia-1 (RHDA1) and with several animal models of chronic kidney disease. Alternate splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2014] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGA8 integrin, alpha 8 [ Homo sapiens ] |
Official Symbol | ITGA8 |
Synonyms | ITGA8; integrin, alpha 8; integrin alpha-8; |
Gene ID | 8516 |
mRNA Refseq | NM_003638 |
Protein Refseq | NP_003629 |
MIM | 604063 |
UniProt ID | P53708 |
◆ Recombinant Proteins | ||
ITGA8-4639M | Recombinant Mouse ITGA8 Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGA8-6497Z | Recombinant Zebrafish ITGA8 | +Inquiry |
ITGA8-246H | Recombinant Human ITGA8 Protein, His/GST-tagged | +Inquiry |
ITGA8-1212H | Recombinant Human ITGA8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Itga8-3598M | Recombinant Mouse Itga8 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGA8 Products
Required fields are marked with *
My Review for All ITGA8 Products
Required fields are marked with *
0
Inquiry Basket