Recombinant Human ITGA9 protein, GST-tagged

• Cat.No.: ITGA9-1236H
• Product Overview: Recombinant Human ITGA9 protein(462-613 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 462-613 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: VITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPEEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ITGA9 integrin, alpha 9 [ Homo sapiens ]
• Official Symbol: ITGA9
• Synonyms: ITGA9; integrin, alpha 9; integrin alpha-9; ALPHA RLC; integrin; alpha 4 like; ITGA4L; RLC; integrin alpha-RLC; ALPHA-RLC
• Gene ID: 3680
• mRNA Refseq: NM_002207
• Protein Refseq: NP_002198
• MIM: 603963
• UniProt ID: Q13797