Recombinant Human ITGAX protein, His-tagged
Cat.No. : | ITGAX-183H |
Product Overview : | Recombinant Human ITGAX protein(NP_000878)(21-352 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-352 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | NLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ITGAX integrin, alpha X (complement component 3 receptor 4 subunit) [ Homo sapiens ] |
Official Symbol | ITGAX |
Synonyms | ITGAX; integrin, alpha X (complement component 3 receptor 4 subunit); CD11C, integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin alpha-X; CD11c; leu M5, alpha subunit; p150 95 integrin alpha chain; CD11 antigen-like family member C; leukocyte adhesion receptor p150,95; myeloid membrane antigen, alpha subunit; leukocyte surface antigen p150,95, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); CD11C; SLEB6; |
Gene ID | 3687 |
mRNA Refseq | NM_000887 |
Protein Refseq | NP_000878 |
MIM | 151510 |
UniProt ID | P20702 |
◆ Recombinant Proteins | ||
ITGAX-2812M | Recombinant Mouse ITGAX Protein (20-1116 aa), His-MBP-tagged | +Inquiry |
ITGAX-183H | Recombinant Human ITGAX protein, His-tagged | +Inquiry |
ITGAX-4987H | Recombinant Human ITGAX Protein, GST-tagged | +Inquiry |
ITGAX-266H | Recombinant Human ITGAX | +Inquiry |
ITGAX-4324H | Recombinant Human ITGAX Protein (Met1-Pro1107), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGAX Products
Required fields are marked with *
My Review for All ITGAX Products
Required fields are marked with *