Recombinant Human ITGAX protein, His-tagged
| Cat.No. : | ITGAX-183H |
| Product Overview : | Recombinant Human ITGAX protein(NP_000878)(21-352 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-352 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | NLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMA |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ITGAX integrin, alpha X (complement component 3 receptor 4 subunit) [ Homo sapiens ] |
| Official Symbol | ITGAX |
| Synonyms | ITGAX; integrin, alpha X (complement component 3 receptor 4 subunit); CD11C, integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin alpha-X; CD11c; leu M5, alpha subunit; p150 95 integrin alpha chain; CD11 antigen-like family member C; leukocyte adhesion receptor p150,95; myeloid membrane antigen, alpha subunit; leukocyte surface antigen p150,95, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); CD11C; SLEB6; |
| Gene ID | 3687 |
| mRNA Refseq | NM_000887 |
| Protein Refseq | NP_000878 |
| MIM | 151510 |
| UniProt ID | P20702 |
| ◆ Recombinant Proteins | ||
| ITGAX-1553H | Recombinant Human ITGAX protein, His-tagged | +Inquiry |
| ITGAX-2812M | Recombinant Mouse ITGAX Protein (20-1116 aa), His-MBP-tagged | +Inquiry |
| Itgax-1554M | Recombinant Mouse Itgax protein, His & GST-tagged | +Inquiry |
| ITGAX-4324H | Recombinant Human ITGAX Protein (Met1-Pro1107), C-His tagged | +Inquiry |
| ITGAX-4119H | Recombinant Human ITGAX protein(Met1-Pro1107 & Met1-Asn700), Flag&His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGAX Products
Required fields are marked with *
My Review for All ITGAX Products
Required fields are marked with *
