Recombinant Human ITGB1 protein
Cat.No. : | ITGB1-26860TH |
Product Overview : | Recombinant Human ITGB1 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene. |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 88.4 kDa |
AA Sequence : | MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGC PPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMD LSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSL TNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAY NSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGF TEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEIC SNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVES RDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLI WKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK |
Applications : | Antibody Production; Functional Study: Recommended usage only, not validated yet; Compound Screening: Recommended usage only, not validated yet. |
Notes : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) [ Homo sapiens ] |
Official Symbol | ITGB1 |
Synonyms | ITGB1; integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12); FNRB, MDF2, MSK12; integrin beta-1; CD29; GPIIA; integrin VLA-4 beta subunit; very late activation protein, beta polypeptide; FNRB; MDF2; VLAB; MSK12; VLA-BETA; |
Gene ID | 3688 |
mRNA Refseq | NM_002211 |
Protein Refseq | NP_002202 |
MIM | 135630 |
UniProt ID | P05556 |
Chromosome Location | 10p11.2 |
Pathway | Adaptive Immune System, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; |
Function | actin binding; alpha-actinin binding; collagen binding; fibronectin binding; glycoprotein binding; integrin binding; laminin binding; peptide binding; protease binding; protein binding; protein domain specific binding; protein heterodimerization activity; protein kinase binding; receptor activity; |
◆ Native Proteins | ||
ITGB1-152H | Recombinant Full Length Human ITGB1 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB1-5127HCL | Recombinant Human ITGB1 293 Cell Lysate | +Inquiry |
ITGB1-5128HCL | Recombinant Human ITGB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB1 Products
Required fields are marked with *
My Review for All ITGB1 Products
Required fields are marked with *