Recombinant Human ITGB1 protein
| Cat.No. : | ITGB1-26860TH |
| Product Overview : | Recombinant Human ITGB1 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene. |
| Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Molecular Mass : | 88.4 kDa |
| AA Sequence : | MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGC PPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMD LSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSL TNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAY NSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGF TEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEIC SNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVES RDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLI WKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK |
| Applications : | Antibody Production; Functional Study: Recommended usage only, not validated yet; Compound Screening: Recommended usage only, not validated yet. |
| Notes : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) [ Homo sapiens ] |
| Official Symbol | ITGB1 |
| Synonyms | ITGB1; integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12); FNRB, MDF2, MSK12; integrin beta-1; CD29; GPIIA; integrin VLA-4 beta subunit; very late activation protein, beta polypeptide; FNRB; MDF2; VLAB; MSK12; VLA-BETA; |
| Gene ID | 3688 |
| mRNA Refseq | NM_002211 |
| Protein Refseq | NP_002202 |
| MIM | 135630 |
| UniProt ID | P05556 |
| Chromosome Location | 10p11.2 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; |
| Function | actin binding; alpha-actinin binding; collagen binding; fibronectin binding; glycoprotein binding; integrin binding; laminin binding; peptide binding; protease binding; protein binding; protein domain specific binding; protein heterodimerization activity; protein kinase binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| ITGB1-233H | Recombinant Human ITGB1 Protein, His-tagged | +Inquiry |
| ITGB1-3321C | Recombinant Chicken ITGB1 | +Inquiry |
| RFL13472OF | Recombinant Full Length Sheep Integrin Beta-1(Itgb1) Protein, His-Tagged | +Inquiry |
| Itgb1-1624H | Active Recombinant Human Itgb1 protein, His-tagged | +Inquiry |
| RFL23428HF | Recombinant Full Length Human Integrin Beta-1(Itgb1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGB1-5127HCL | Recombinant Human ITGB1 293 Cell Lysate | +Inquiry |
| ITGB1-215HKCL | Human ITGB1 Knockdown Cell Lysate | +Inquiry |
| ITGB1-5128HCL | Recombinant Human ITGB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB1 Products
Required fields are marked with *
My Review for All ITGB1 Products
Required fields are marked with *




