Recombinant Human ITGB1 protein, His-tagged

Cat.No. : ITGB1-3007H
Product Overview : Recombinant Human ITGB1 protein(600-728 aa), fused to His tag, was expressed in E. coli.
Availability August 16, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 600-728 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : EASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPD
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) [ Homo sapiens ]
Official Symbol ITGB1
Synonyms ITGB1; integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12); FNRB, MDF2, MSK12; integrin beta-1; CD29; GPIIA; integrin VLA-4 beta subunit; very late activation protein, beta polypeptide; FNRB; MDF2; VLAB; MSK12; VLA-BETA;
Gene ID 3688
mRNA Refseq NM_002211
Protein Refseq NP_002202
MIM 135630
UniProt ID P05556

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGB1 Products

Required fields are marked with *

My Review for All ITGB1 Products

Required fields are marked with *

0
cart-icon