Recombinant Human ITGB1BP1 Protein, GST-tagged
Cat.No. : | ITGB1BP1-4985H |
Product Overview : | Human ITGB1BP1 full-length ORF ( AAH12264, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein are derived from alternatively spliced transcripts. The shorter form of this protein does not interact with the beta1 integrin cytoplasmic domain. The longer form is a phosphoprotein and the extent of its phosphorylation is regulated by the cell-matrix interaction, suggesting an important role of this protein during integrin-dependent cell adhesion. [provided by RefSeq |
Molecular Mass : | 47.74 kDa |
AA Sequence : | MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGB1BP1 integrin beta 1 binding protein 1 [ Homo sapiens ] |
Official Symbol | ITGB1BP1 |
Synonyms | ITGB1BP1; integrin beta 1 binding protein 1; integrin beta-1-binding protein 1; bodenin; ICAP 1A; ICAP 1alpha; ICAP 1B; ICAP1; ICAP1A; ICAP1B; integrin cytoplasmic domain associated protein 1; integrin cytoplasmic domain associated protein 1 alpha; integrin cytoplasmic domain associated protein 1 beta; ICAP-1; integrin cytoplasmic domain-associated protein 1; integrin cytoplasmic domain-associated protein 1-beta; integrin cytoplasmic domain-associated protein 1-alpha; ICAP-1A; ICAP-1B; ICAP-1alpha; DKFZp686K08158; |
Gene ID | 9270 |
mRNA Refseq | NM_004763 |
Protein Refseq | NP_004754 |
MIM | 607153 |
UniProt ID | O14713 |
◆ Recombinant Proteins | ||
ITGB1BP1-3530Z | Recombinant Zebrafish ITGB1BP1 | +Inquiry |
ITGB1BP1-4643M | Recombinant Mouse ITGB1BP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGB1BP1-8362M | Recombinant Mouse ITGB1BP1 Protein | +Inquiry |
ITGB1BP1-5761HF | Recombinant Full Length Human ITGB1BP1 Protein, GST-tagged | +Inquiry |
ITGB1BP1-5316C | Recombinant Chicken ITGB1BP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB1BP1-5126HCL | Recombinant Human ITGB1BP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB1BP1 Products
Required fields are marked with *
My Review for All ITGB1BP1 Products
Required fields are marked with *
0
Inquiry Basket