Recombinant Human ITGB1BP2 Protein, GST-tagged
Cat.No. : | ITGB1BP2-4982H |
Product Overview : | Human ITGB1BP2 full-length ORF ( NP_036410.1, 1 a.a. - 347 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein with two cysteine and histidine-rich (CHORD) domains, PXXP motifs, YXXI/P motifs, putative SH2 and SH3 domain binding motifs, and an acidic region at the C-terminus that can bind calcium. Two hybrid analysis showed that this protein interacts with the cytoplasmic domain of the beta 1 integrin subunit and is thought to act as a chaperone protein. Studies in the mouse ortholog of this gene indicate that absence of this gene in mouse results in failed cardiac hypertrophy in response to mechanical stress. Alternative splicing results in multiple transcript variants encoding different isoforms, including an isoform that lacks several domains, including one of the CHORD domains. [provided by RefSeq, May 2017] |
Molecular Mass : | 64.8 kDa |
AA Sequence : | MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGB1BP2 integrin beta 1 binding protein (melusin) 2 [ Homo sapiens ] |
Official Symbol | ITGB1BP2 |
Synonyms | ITGB1BP2; integrin beta 1 binding protein (melusin) 2; integrin beta-1-binding protein 2; CHORDC3; ITGB1BP; MELUSIN; MSTP015; MGC119214; |
Gene ID | 26548 |
mRNA Refseq | NM_012278 |
Protein Refseq | NP_036410 |
MIM | 300332 |
UniProt ID | Q9UKP3 |
◆ Recombinant Proteins | ||
ITGB1BP2-4982H | Recombinant Human ITGB1BP2 Protein, GST-tagged | +Inquiry |
ITGB1BP2-2646H | Recombinant Human ITGB1BP2 Protein, MYC/DDK-tagged | +Inquiry |
ITGB1BP2-5762HF | Recombinant Full Length Human ITGB1BP2 Protein, GST-tagged | +Inquiry |
ITGB1BP2-178H | Recombinant Human ITGB1BP2, GST-tagged | +Inquiry |
Itgb1bp2-3604M | Recombinant Mouse Itgb1bp2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB1BP2-878HCL | Recombinant Human ITGB1BP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB1BP2 Products
Required fields are marked with *
My Review for All ITGB1BP2 Products
Required fields are marked with *
0
Inquiry Basket