Recombinant Human ITGB1BP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ITGB1BP2-2946H |
Product Overview : | ITGB1BP2 MS Standard C13 and N15-labeled recombinant protein (NP_036410) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein with two cysteine and histidine-rich (CHORD) domains, PXXP motifs, YXXI/P motifs, putative SH2 and SH3 domain binding motifs, and an acidic region at the C-terminus that can bind calcium. Two hybrid analysis showed that this protein interacts with the cytoplasmic domain of the beta 1 integrin subunit and is thought to act as a chaperone protein. Studies in the mouse ortholog of this gene indicate that absence of this gene in mouse results in failed cardiac hypertrophy in response to mechanical stress. Alternative splicing results in multiple transcript variants encoding different isoforms, including an isoform that lacks several domains, including one of the CHORD domains. |
Molecular Mass : | 38.2 kDa |
AA Sequence : | MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ITGB1BP2 integrin subunit beta 1 binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | ITGB1BP2 |
Synonyms | ITGB1BP2; integrin beta 1 binding protein (melusin) 2; integrin beta-1-binding protein 2; CHORDC3; ITGB1BP; MELUSIN; MSTP015; MGC119214; |
Gene ID | 26548 |
mRNA Refseq | NM_012278 |
Protein Refseq | NP_036410 |
MIM | 300332 |
UniProt ID | Q9UKP3 |
◆ Recombinant Proteins | ||
ITGB1BP2-178H | Recombinant Human ITGB1BP2, GST-tagged | +Inquiry |
Itgb1bp2-3604M | Recombinant Mouse Itgb1bp2 Protein, Myc/DDK-tagged | +Inquiry |
ITGB1BP2-5762HF | Recombinant Full Length Human ITGB1BP2 Protein, GST-tagged | +Inquiry |
ITGB1BP2-4982H | Recombinant Human ITGB1BP2 Protein, GST-tagged | +Inquiry |
ITGB1BP2-2946H | Recombinant Human ITGB1BP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB1BP2-878HCL | Recombinant Human ITGB1BP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB1BP2 Products
Required fields are marked with *
My Review for All ITGB1BP2 Products
Required fields are marked with *
0
Inquiry Basket