Recombinant Human ITGB2 protein, T7/His-tagged
| Cat.No. : | ITGB2-181H |
| Product Overview : | Recombinant human CD18 cDNA (23 - 700 aa, derived from BC005861) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 23-700 a.a. |
| Form : | 0.20 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFELQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRP QLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLD DLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQ FQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDN LYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSR VFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQV LPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQ CLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECS GRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERD SEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) [ Homo sapiens ] |
| Official Symbol | ITGB2 |
| Synonyms | ITGB2; integrin beta-2; LFA 1; MAC 1; integrin beta chain, beta 2; LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1; |
| Gene ID | 3689 |
| mRNA Refseq | NM_000211 |
| Protein Refseq | NP_000202 |
| MIM | 600065 |
| UniProt ID | P05107 |
| Chromosome Location | 21q22.3 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; CXCR3-mediated signaling events, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; |
| Function | binding; glycoprotein binding; protein kinase binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| ITGB2-2556H | Recombinant Human ITGB2 protein(451-520 aa), C-His-tagged | +Inquiry |
| RFL179HF | Recombinant Full Length Human Integrin Beta-2(Itgb2) Protein, His-Tagged | +Inquiry |
| ITGB2-279HF | Recombinant Full Length Human ITGB2 Protein | +Inquiry |
| ITGB2-1052H | Recombinant Human ITGB2 Protein (Gly124-Leu363), N-GST tagged | +Inquiry |
| Itgb2-3605M | Recombinant Mouse Itgb2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGB2-5125HCL | Recombinant Human ITGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB2 Products
Required fields are marked with *
My Review for All ITGB2 Products
Required fields are marked with *
