Recombinant Human ITGB3 protein(631-700 aa), C-His-tagged

Cat.No. : ITGB3-2555H
Product Overview : Recombinant Human ITGB3 protein(P05106)(631-700 aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 631-700 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 10.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : PDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSS
Gene Name ITGB3 integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) [ Homo sapiens ]
Official Symbol ITGB3
Synonyms ITGB3; integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61); GP3A; integrin beta-3; CD61; GPIIIa; platelet glycoprotein IIIa; platelet membrane glycoprotein IIIa; GT; BDPLT2;
Gene ID 3690
mRNA Refseq NM_000212
Protein Refseq NP_000203
UniProt ID P05106

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGB3 Products

Required fields are marked with *

My Review for All ITGB3 Products

Required fields are marked with *

0
cart-icon
0
compare icon