Recombinant Human ITGB6 protein, GST-tagged
Cat.No. : | ITGB6-301520H |
Product Overview : | Recombinant Human ITGB6 (596-709 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asp596-Pro709 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | DCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ITGB6 integrin, beta 6 [ Homo sapiens ] |
Official Symbol | ITGB6 |
Synonyms | ITGB6; integrin, beta 6; integrin beta-6; |
Gene ID | 3694 |
mRNA Refseq | NM_000888 |
Protein Refseq | NP_000879 |
MIM | 147558 |
UniProt ID | P18564 |
◆ Recombinant Proteins | ||
ITGB6-5785HF | Recombinant Full Length Human ITGB6 Protein, GST-tagged | +Inquiry |
ITGB6-253H | Recombinant Human ITGB6 Protein, His-tagged | +Inquiry |
RFL9156CF | Recombinant Full Length Guinea Pig Integrin Beta-6(Itgb6) Protein, His-Tagged | +Inquiry |
ITGB6-6454H | Recombinant Human ITGB6 protein, His-tagged | +Inquiry |
ITGB6-3196H | Recombinant Human ITGB6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB6-5122HCL | Recombinant Human ITGB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB6 Products
Required fields are marked with *
My Review for All ITGB6 Products
Required fields are marked with *
0
Inquiry Basket