Recombinant Human ITGB8 Protein, GST-tagged
Cat.No. : | ITGB8-4964H |
Product Overview : | Human ITGB8 partial ORF ( NP_002205, 392 a.a. - 503 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the integrin beta chain family and encodes a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq |
Molecular Mass : | 38.06 kDa |
AA Sequence : | VENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGB8 integrin, beta 8 [ Homo sapiens ] |
Official Symbol | ITGB8 |
Synonyms | ITGB8; integrin, beta 8; integrin beta-8; |
Gene ID | 3696 |
mRNA Refseq | NM_002214 |
Protein Refseq | NP_002205 |
MIM | 604160 |
UniProt ID | P26012 |
◆ Recombinant Proteins | ||
RFL24947HF | Recombinant Full Length Human Integrin Beta-8(Itgb8) Protein, His-Tagged | +Inquiry |
ITGB8-2297R | Recombinant Rabbit ITGB8 Protein (146-384 aa), His-Myc-tagged | +Inquiry |
RFL30290OF | Recombinant Full Length Rabbit Integrin Beta-8(Itgb8) Protein, His-Tagged | +Inquiry |
ITGB8-255H | Recombinant Human ITGB8 Protein, His-tagged | +Inquiry |
ITGB8-2138R | Recombinant Rhesus Macaque ITGB8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB8-881HCL | Recombinant Human ITGB8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB8 Products
Required fields are marked with *
My Review for All ITGB8 Products
Required fields are marked with *