Recombinant Human ITGB8 Protein, GST-tagged

• Cat.No.: ITGB8-4964H
• Product Overview: Human ITGB8 partial ORF ( NP_002205, 392 a.a. - 503 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the integrin beta chain family and encodes a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
• Molecular Mass: 38.06 kDa
• AA Sequence: VENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITGB8 integrin, beta 8 [ Homo sapiens ]
• Official Symbol: ITGB8
• Synonyms: ITGB8; integrin, beta 8; integrin beta-8
• Gene ID: 3696
• mRNA Refseq: NM_002214
• Protein Refseq: NP_002205
• MIM: 604160
• UniProt ID: P26012