Recombinant Human ITIH4 protein, His-SUMO-tagged
Cat.No. : | ITIH4-4393H |
Product Overview : | Recombinant Human ITIH4 protein(Q14624)(689-930aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 689-930aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.9 kDa |
AA Sequence : | RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ITIH4 inter-alpha-trypsin inhibitor heavy chain family, member 4 [ Homo sapiens ] |
Official Symbol | ITIH4 |
Synonyms | ITIH4; inter-alpha-trypsin inhibitor heavy chain family, member 4; inter alpha (globulin) inhibitor H4 (plasma Kallikrein sensitive glycoprotein) , ITIHL1; inter-alpha-trypsin inhibitor heavy chain H4; H4P; IHRP; plasma Kallikrein sensitive glycoprotein; ITI heavy chain H4; inter-alpha-inhibitor heavy chain 4; plasma kallikrein-sensitive glycoprotein 120; inter-alpha-trypsin inhibitor, heavy chain-like, 1; inter-alpha-trypsin inhibitor family heavy chain-related protein; inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein); GP120; PK120; ITIHL1; PK-120; ITI-HC4; DKFZp686G21125; |
Gene ID | 3700 |
mRNA Refseq | NM_001166449 |
Protein Refseq | NP_001159921 |
MIM | 600564 |
UniProt ID | Q14624 |
◆ Recombinant Proteins | ||
ITIH4-1565H | Recombinant Human ITIH4 protein, His-tagged | +Inquiry |
Itih4-1567R | Recombinant Rat Itih4 protein, His & GST-tagged | +Inquiry |
ITIH4-43HFL | Recombinant Human ITIH4 Protein, Full Length, C-6×His tagged | +Inquiry |
Itih4-1566M | Recombinant Mouse Itih4 protein, His & T7-tagged | +Inquiry |
ITIH4-1221H | Recombinant Human ITIH4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITIH4 Products
Required fields are marked with *
My Review for All ITIH4 Products
Required fields are marked with *