Recombinant Human ITIH4 protein, His-SUMO-tagged

Cat.No. : ITIH4-4393H
Product Overview : Recombinant Human ITIH4 protein(Q14624)(689-930aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 689-930aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.9 kDa
AA Sequence : RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ITIH4 inter-alpha-trypsin inhibitor heavy chain family, member 4 [ Homo sapiens ]
Official Symbol ITIH4
Synonyms ITIH4; inter-alpha-trypsin inhibitor heavy chain family, member 4; inter alpha (globulin) inhibitor H4 (plasma Kallikrein sensitive glycoprotein) , ITIHL1; inter-alpha-trypsin inhibitor heavy chain H4; H4P; IHRP; plasma Kallikrein sensitive glycoprotein; ITI heavy chain H4; inter-alpha-inhibitor heavy chain 4; plasma kallikrein-sensitive glycoprotein 120; inter-alpha-trypsin inhibitor, heavy chain-like, 1; inter-alpha-trypsin inhibitor family heavy chain-related protein; inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein); GP120; PK120; ITIHL1; PK-120; ITI-HC4; DKFZp686G21125;
Gene ID 3700
mRNA Refseq NM_001166449
Protein Refseq NP_001159921
MIM 600564
UniProt ID Q14624

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITIH4 Products

Required fields are marked with *

My Review for All ITIH4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon