Recombinant Human ITM2A Protein, His tagged
Cat.No. : | ITM2A-001H |
Product Overview : | Recombinant Human ITM2A Protein (80-263 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 80-263 aa |
Description : | This gene encodes a type II membrane protein that belongs to the ITM2 family. Studies in mouse suggest that it may be involved in osteo- and chondrogenic differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 22 kDa |
Purity : | > 90% by SDS-PAGE |
AA Sequence : | MPKSTIYRGEMCFFDSEDPANSLRGGEPNFLPVTEEADIREDDNIAIIDVPVPSFSDSDPAAIIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELFGKLASGRYLPQTYVVREDLVAVEEIRDVSNLGIFIYQLCNNRKSFRLRRRDLLLGFNKRAIDKCWKIRHFPNEFIVETKICQEHHHHHHHH |
Endotoxin : | < 1.0 EU/μg by LAL |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 8% Trehalose, 10% Glycerol |
Concentration : | 1 mg/mL by BCA |
Gene Name | ITM2A integral membrane protein 2A [ Homo sapiens (human) ] |
Official Symbol | ITM2A |
Synonyms | ITM2A; integral membrane protein 2A; E25A; BRICD2A; integral membrane protein 2A; BRICHOS domain containing 2A |
Gene ID | 9452 |
mRNA Refseq | NM_004867 |
Protein Refseq | NP_004858 |
MIM | 300222 |
UniProt ID | Q6IBC9 |
◆ Native Proteins | ||
ITM2A-001H | Recombinant Human ITM2A Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITM2A-5118HCL | Recombinant Human ITM2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITM2A Products
Required fields are marked with *
My Review for All ITM2A Products
Required fields are marked with *
0
Inquiry Basket