Recombinant Human ITM2A Protein, His tagged

Cat.No. : ITM2A-001H
Product Overview : Recombinant Human ITM2A Protein (80-263 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 80-263 aa
Description : This gene encodes a type II membrane protein that belongs to the ITM2 family. Studies in mouse suggest that it may be involved in osteo- and chondrogenic differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 22 kDa
Purity : > 90% by SDS-PAGE
AA Sequence : MPKSTIYRGEMCFFDSEDPANSLRGGEPNFLPVTEEADIREDDNIAIIDVPVPSFSDSDPAAIIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELFGKLASGRYLPQTYVVREDLVAVEEIRDVSNLGIFIYQLCNNRKSFRLRRRDLLLGFNKRAIDKCWKIRHFPNEFIVETKICQEHHHHHHHH
Endotoxin : < 1.0 EU/μg by LAL
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 8% Trehalose, 10% Glycerol
Concentration : 1 mg/mL by BCA
Gene Name ITM2A integral membrane protein 2A [ Homo sapiens (human) ]
Official Symbol ITM2A
Synonyms ITM2A; integral membrane protein 2A; E25A; BRICD2A; integral membrane protein 2A; BRICHOS domain containing 2A
Gene ID 9452
mRNA Refseq NM_004867
Protein Refseq NP_004858
MIM 300222
UniProt ID Q6IBC9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITM2A Products

Required fields are marked with *

My Review for All ITM2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon