Recombinant Human IZUMO1R Protein, His/Avi tagged, Biotinylated

Cat.No. : IZUMO1R-18H
Product Overview : Biotinylated Recombinant Human IZUMO1R Protein with His/Avi tag was expressed in HEK293.
Availability September 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Avi&His
Description : Enables signaling receptor activity. Predicted to be involved in cell adhesion; fusion of sperm to egg plasma membrane involved in single fertilization; and sperm-egg recognition. Predicted to be located in extracellular region and plasma membrane. Predicted to be anchored component of external side of plasma membrane.
Form : Liquid
Molecular Mass : The protein has a calculated MW of 26 kDa.
AA Sequence : GDKLLSVCMNSKRHKQEPGPEDELYQECRPWEDNACCTRSTSWEAHLEEPLLFNFSMMHCGLLTPACRKHFIQAICFHECSPNLGPWIQPVVPNGQEEQRVWGVPLCQEDCEDWWRACHSSLTCKSNWLHGWDWSEEKKHCPAHEPCLPFSYHFPTPDDLCEKIWNNTFKASPERRNSGRCLQKWFEPTLSNPNVEVALHFAGGLNDIFEAQKIEWHEHHHHHH
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.38 mg/mL by BCA
Storage Buffer : Liquid in sterile PBS, pH 7.4
Conjugation : Biotin
Gene Name IZUMO1R IZUMO1 receptor, JUNO [ Homo sapiens (human) ]
Official Symbol IZUMO1R
Synonyms IZUMO1R; IZUMO1 receptor, JUNO; JUNO; FOLR4; Folbp3; FR-delta; sperm-egg fusion protein Juno; IZUMO1 receptor protein JUNO; IZUMO1 receptor, JUNO, FR-delta; folate receptor 4 (delta) homolog; folate receptor 4, delta (putative); folate receptor delta; probable folate receptor delta
Gene ID 390243
mRNA Refseq NM_001393610
Protein Refseq NP_001380539
MIM 615737
UniProt ID A6ND01

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IZUMO1R Products

Required fields are marked with *

My Review for All IZUMO1R Products

Required fields are marked with *

0
cart-icon