Recombinant Human JAG1 protein, GST-tagged
Cat.No. : | JAG1-7434H |
Product Overview : | Recombinant Human JAG1 protein(856-1067 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | GST |
Protein Length : | 856-1067 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | QEVSGRPCITMGSVIRDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTD |
Gene Name | JAG1 jagged 1 [ Homo sapiens ] |
Official Symbol | JAG1 |
Synonyms | JAG1; jagged 1; AGS, Alagille syndrome , JAGL1; protein jagged-1; AHD; AWS; CD339; HJ1; AGS; JAGL1; MGC104644; |
Gene ID | 182 |
mRNA Refseq | NM_000214 |
Protein Refseq | NP_000205 |
UniProt ID | P78504 |
◆ Recombinant Proteins | ||
JAG1-566H | Recombinant Human JAG1 | +Inquiry |
JAG1-1762R | Recombinant Rhesus Monkey JAG1 Protein, hIgG1-tagged | +Inquiry |
JAG1-380H | Active Recombinant Human JAG1, Fc-tagged | +Inquiry |
JAG1-3226H | Active Recombinant Human JAG1 protein, His-tagged | +Inquiry |
JAG1-1115HFL | Recombinant Full Length Human JAG1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAG1-2382HCL | Recombinant Human JAG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAG1 Products
Required fields are marked with *
My Review for All JAG1 Products
Required fields are marked with *