Recombinant Human JAK3 protein, His-tagged
Cat.No. : | JAK3-3174H |
Product Overview : | Recombinant Human JAK3 protein(351-597 aa), fused to His tag, was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 351-597 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LTTDSQHFFCKEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNPLGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPKEKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCRHEVVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | JAK3 Janus kinase 3 [ Homo sapiens ] |
Official Symbol | JAK3 |
Synonyms | JAK3; Janus kinase 3; tyrosine-protein kinase JAK3; JAK 3; JAK3_HUMAN; JAKL; L JAK; leukocyte Janus kinase; LJAK; tyrosine protein kinase JAK3; Janus kinase 3 (a protein tyrosine kinase, leukocyte); JAK-3; L-JAK; |
Gene ID | 3718 |
mRNA Refseq | NM_000215 |
Protein Refseq | NP_000206 |
MIM | 600173 |
UniProt ID | P52333 |
◆ Recombinant Proteins | ||
JAK3-467H | Active Recombinant Human JAK3 Protein, His-tagged | +Inquiry |
JAK3-466H | Recombinant Human JAK3 | +Inquiry |
JAK37530H | Recombinant Human JAK3 (810-1104) Protein | +Inquiry |
JAK3-27631TH | Recombinant Human JAK3 | +Inquiry |
JAK37392H | Recombinant Human JAK3 (810-1100) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAK3-5106HCL | Recombinant Human JAK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAK3 Products
Required fields are marked with *
My Review for All JAK3 Products
Required fields are marked with *
0
Inquiry Basket