"JDP2" Related Products

Expand
Expand

Recombinant Human JDP2 protein, Arginine-tagged

Cat.No.: JDP2-168H
Product Overview: Recombinant human JDP2 cDNA (162 aa, Isoform-I) fused with 29aa Tag at N-terminal and C-terminal flexible linker domain & eleven arginine (11R Tag) as membrane penetration domain to enable penetration across the plasma membrane of mammalian cells was expr
Source: E. coli
Species: Human
Tag: Arginine
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMI APLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELK QERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKKESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: JDP2 Jun dimerization protein 2 [ Homo sapiens ]
Official Symbol: JDP2
Synonyms: JDP2; Jun dimerization protein 2; jun dimerization protein 2; JUNDM2; progesterone receptor co activator; progesterone receptor co-activator;
Gene ID: 122953
mRNA Refseq: NM_001135047
Protein Refseq: NP_001128519
MIM: 608657
UniProt ID: Q8WYK2
Chromosome Location: 14q24.2
Pathway: ATF-2 transcription factor network, organism-specific biosystem;
Function: double-stranded DNA binding; protein heterodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.