Recombinant Human JDP2 protein, Arginine-tagged

• Cat.No.: JDP2-168H
• Product Overview: Recombinant human JDP2 cDNA (162 aa, Isoform-I) fused with 29aa Tag at N-terminal and C-terminal flexible linker domain & eleven arginine (11R Tag) as membrane penetration domain to enable penetration across the plasma membrane of mammalian cells was expr

Specification

• Species: Human
• Source: E.coli
• Protein Length: 162 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMI APLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELK QERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKKESGGGGSPGRRRRRRRRRRR
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: JDP2 Jun dimerization protein 2 [ Homo sapiens ]
• Official Symbol: JDP2
• Synonyms: JDP2; Jun dimerization protein 2; jun dimerization protein 2; JUNDM2; progesterone receptor co activator; progesterone receptor co-activator
• Gene ID: 122953
• mRNA Refseq: NM_001135047
• Protein Refseq: NP_001128519
• MIM: 608657
• UniProt ID: Q8WYK2
• Chromosome Location: 14q24.2
• Pathway: ATF-2 transcription factor network, organism-specific biosystem
• Function: double-stranded DNA binding; protein heterodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity