Recombinant Human JDP2 protein, Arginine-tagged

Cat.No. : JDP2-168H
Product Overview : Recombinant human JDP2 cDNA (162 aa, Isoform-I) fused with 29aa Tag at N-terminal and C-terminal flexible linker domain & eleven arginine (11R Tag) as membrane penetration domain to enable penetration across the plasma membrane of mammalian cells was expr
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 162 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMI APLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELK QERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKKESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name JDP2 Jun dimerization protein 2 [ Homo sapiens ]
Official Symbol JDP2
Synonyms JDP2; Jun dimerization protein 2; jun dimerization protein 2; JUNDM2; progesterone receptor co activator; progesterone receptor co-activator;
Gene ID 122953
mRNA Refseq NM_001135047
Protein Refseq NP_001128519
MIM 608657
UniProt ID Q8WYK2
Chromosome Location 14q24.2
Pathway ATF-2 transcription factor network, organism-specific biosystem;
Function double-stranded DNA binding; protein heterodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All JDP2 Products

Required fields are marked with *

My Review for All JDP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon