Recombinant Human JDP2 protein, Arginine-tagged
Cat.No. : | JDP2-168H |
Product Overview : | Recombinant human JDP2 cDNA (162 aa, Isoform-I) fused with 29aa Tag at N-terminal and C-terminal flexible linker domain & eleven arginine (11R Tag) as membrane penetration domain to enable penetration across the plasma membrane of mammalian cells was expr |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 162 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMI APLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELK QERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKKESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | JDP2 Jun dimerization protein 2 [ Homo sapiens ] |
Official Symbol | JDP2 |
Synonyms | JDP2; Jun dimerization protein 2; jun dimerization protein 2; JUNDM2; progesterone receptor co activator; progesterone receptor co-activator; |
Gene ID | 122953 |
mRNA Refseq | NM_001135047 |
Protein Refseq | NP_001128519 |
MIM | 608657 |
UniProt ID | Q8WYK2 |
Chromosome Location | 14q24.2 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; |
Function | double-stranded DNA binding; protein heterodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
JDP2-4674M | Recombinant Mouse JDP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
JDP2-8418M | Recombinant Mouse JDP2 Protein | +Inquiry |
JDP2-168H | Recombinant Human JDP2 protein, Arginine-tagged | +Inquiry |
JDP2-621Z | Recombinant Zebrafish JDP2 | +Inquiry |
JDP2-2795R | Recombinant Rat JDP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JDP2-5104HCL | Recombinant Human JDP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JDP2 Products
Required fields are marked with *
My Review for All JDP2 Products
Required fields are marked with *