Recombinant Human JMJD5 protein, His-tagged

Cat.No. : JMJD5-206H
Product Overview : Recombinant Human JMJD5 Protein(NP_001138820.1)(238-416 aa) is expressed from E. coli with a His Tag.
Availability August 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 238-416 aa
Description : This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described.
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4), 5% trehalose and 5% mannitol are added as protectants before lyophilization.
Bio-activity : Not tested
AA Sequence : EVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS
Endotoxin : <1.0 EU per μg protein as determined by the LAL method.
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Applications : Blocking peptide
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Gene Name KDM8
Official Symbol KDM8
Synonyms FLJ13798
Gene ID 79831
mRNA Refseq NM_001145348.2
Protein Refseq NP_001138820.1
MIM 611917
UniProt ID Q8N371

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KDM8 Products

Required fields are marked with *

My Review for All KDM8 Products

Required fields are marked with *

0
cart-icon