Recombinant Human JMJD5 protein, His-tagged
Cat.No. : | JMJD5-206H |
Product Overview : | Recombinant Human JMJD5 Protein(NP_001138820.1)(238-416 aa) is expressed from E. coli with a His Tag. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 238-416 aa |
Description : | This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4), 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
Bio-activity : | Not tested |
AA Sequence : | EVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS |
Endotoxin : | <1.0 EU per μg protein as determined by the LAL method. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Applications : | Blocking peptide |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
Gene Name | KDM8 |
Official Symbol | KDM8 |
Synonyms | FLJ13798 |
Gene ID | 79831 |
mRNA Refseq | NM_001145348.2 |
Protein Refseq | NP_001138820.1 |
MIM | 611917 |
UniProt ID | Q8N371 |
◆ Recombinant Proteins | ||
KDM8-3238R | Recombinant Rat KDM8 Protein | +Inquiry |
KDM8-0139H | Recombinant Human KDM8 Protein (T183-S416), Tag Free | +Inquiry |
KDM8-6178H | Recombinant Human KDM8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Kdm8-3684M | Recombinant Mouse Kdm8 Protein, Myc/DDK-tagged | +Inquiry |
KDM8-4244H | Recombinant Human KDM8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDM8-5102HCL | Recombinant Human JMJD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDM8 Products
Required fields are marked with *
My Review for All KDM8 Products
Required fields are marked with *