Recombinant Human JOSD1 protein, GST-tagged
Cat.No. : | JOSD1-301375H |
Product Overview : | Recombinant Human JOSD1 (1-202 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Val202 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | JOSD1 Josephin domain containing 1 [ Homo sapiens ] |
Official Symbol | JOSD1 |
Synonyms | JOSD1; Josephin domain containing 1; Josephin-1; KIAA0063; josephin domain-containing 1; dJ508I15.2; |
Gene ID | 9929 |
mRNA Refseq | NM_014876 |
Protein Refseq | NP_055691 |
UniProt ID | Q15040 |
◆ Recombinant Proteins | ||
JOSD1-175H | Active Recombinant Human JOSD1, His-tagged | +Inquiry |
JOSD1-4444H | Recombinant Human JOSD1 protein, His-SUMO-tagged | +Inquiry |
JOSD1-0360H | Recombinant Human JOSD1 Protein (S2-V202), GST tagged | +Inquiry |
JOSD1-2332R | Recombinant Rhesus monkey JOSD1 Protein, His-tagged | +Inquiry |
JOSD1-4684M | Recombinant Mouse JOSD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JOSD1-5099HCL | Recombinant Human JOSD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JOSD1 Products
Required fields are marked with *
My Review for All JOSD1 Products
Required fields are marked with *
0
Inquiry Basket