Recombinant Human JOSD1 protein, His-SUMO-tagged
Cat.No. : | JOSD1-4444H |
Product Overview : | Recombinant Human JOSD1 protein(Q15040)(1-202aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-202aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.2 kDa |
AA Sequence : | MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | JOSD1 Josephin domain containing 1 [ Homo sapiens ] |
Official Symbol | JOSD1 |
Synonyms | JOSD1; Josephin domain containing 1; Josephin-1; KIAA0063; josephin domain-containing 1; dJ508I15.2; |
Gene ID | 9929 |
mRNA Refseq | NM_014876 |
Protein Refseq | NP_055691 |
UniProt ID | Q15040 |
◆ Recombinant Proteins | ||
JOSD1-165H | Recombinant Human JOSD1, His-tagged | +Inquiry |
JOSD1-2153R | Recombinant Rhesus Macaque JOSD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
JOSD1-4444H | Recombinant Human JOSD1 protein, His-SUMO-tagged | +Inquiry |
JOSD1-301375H | Recombinant Human JOSD1 protein, GST-tagged | +Inquiry |
JOSD1-2798R | Recombinant Rat JOSD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JOSD1-5099HCL | Recombinant Human JOSD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JOSD1 Products
Required fields are marked with *
My Review for All JOSD1 Products
Required fields are marked with *