Recombinant Human JUN protein, His-SUMO-tagged
Cat.No. : | JUN-784H |
Product Overview : | Recombinant Human JUN protein(P05412)(1-331aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-331a.a. |
Tag : | His&SUMO |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
Gene Name | JUN jun proto-oncogene [ Homo sapiens ] |
Official Symbol | JUN |
Synonyms | JUN; jun proto-oncogene; jun oncogene , v jun avian sarcoma virus 17 oncogene homolog , v jun sarcoma virus 17 oncogene homolog (avian); transcription factor AP-1; AP 1; c Jun; p39; jun oncogene; activator protein 1; proto-oncogene c-Jun; enhancer-binding protein AP1; Jun activation domain binding protein; v-jun sarcoma virus 17 oncogene homolog; v-jun avian sarcoma virus 17 oncogene homolog; AP1; AP-1; c-Jun; |
Gene ID | 3725 |
mRNA Refseq | NM_002228 |
Protein Refseq | NP_002219 |
MIM | 165160 |
UniProt ID | P05412 |
◆ Recombinant Proteins | ||
Jun-5214M | Recombinant Mouse Jun protein, His-tagged | +Inquiry |
JUN-2802R | Recombinant Rat JUN Protein, His (Fc)-Avi-tagged | +Inquiry |
JUN-1498G | Recombinant Gallus gallus JUN Protein (Full Length), N-His tagged | +Inquiry |
JUN-2945C | Recombinant Chicken JUN | +Inquiry |
JUN-18H | Recombinant Human JUN protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JUN-5095HCL | Recombinant Human JUN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JUN Products
Required fields are marked with *
My Review for All JUN Products
Required fields are marked with *