Recombinant Human Jun proto-oncogene, AP-1 transcription factor subunit Protein, His tagged
Cat.No. : | JUN-001H |
Product Overview : | Recombinant Human JUN Protein (2-331aa) with His tag was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-331aa |
Description : | This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. |
Tag : | C-His |
Molecular Mass : | 37 kDa |
AA Sequence : | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTFHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
Concentration : | 1 mg/mL by BCA |
Gene Name | JUN Jun proto-oncogene, AP-1 transcription factor subunit [ Homo sapiens (human) ] |
Official Symbol | JUN |
Synonyms | JUN; jun proto-oncogene; jun oncogene , v jun avian sarcoma virus 17 oncogene homolog , v jun sarcoma virus 17 oncogene homolog (avian); transcription factor AP-1; AP 1; c Jun; p39; jun oncogene; activator protein 1; proto-oncogene c-Jun; enhancer-binding protein AP1; Jun activation domain binding protein; v-jun sarcoma virus 17 oncogene homolog; v-jun avian sarcoma virus 17 oncogene homolog; AP1; AP-1; c-Jun |
Gene ID | 3725 |
mRNA Refseq | NM_002228 |
Protein Refseq | NP_002219 |
MIM | 165160 |
UniProt ID | P05412 |
◆ Recombinant Proteins | ||
JUN-715HF | Recombinant Full Length Human JUN Protein, GST-tagged | +Inquiry |
JUN-8483H | Recombinant Human JUN, His-tagged | +Inquiry |
JUN-2156R | Recombinant Rhesus Macaque JUN Protein, His (Fc)-Avi-tagged | +Inquiry |
Jun-5214M | Recombinant Mouse Jun protein, His-tagged | +Inquiry |
JUN-1498G | Recombinant Gallus gallus JUN Protein (Full Length), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JUN-5095HCL | Recombinant Human JUN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JUN Products
Required fields are marked with *
My Review for All JUN Products
Required fields are marked with *