Recombinant Human Jun proto-oncogene, AP-1 transcription factor subunit Protein, His tagged
| Cat.No. : | JUN-001H |
| Product Overview : | Recombinant Human JUN Protein (2-331aa) with His tag was expressed in E. coli. |
| Availability | December 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-331aa |
| Description : | This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. |
| Tag : | C-His |
| Molecular Mass : | 37 kDa |
| AA Sequence : | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTFHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | JUN Jun proto-oncogene, AP-1 transcription factor subunit [ Homo sapiens (human) ] |
| Official Symbol | JUN |
| Synonyms | JUN; jun proto-oncogene; jun oncogene , v jun avian sarcoma virus 17 oncogene homolog , v jun sarcoma virus 17 oncogene homolog (avian); transcription factor AP-1; AP 1; c Jun; p39; jun oncogene; activator protein 1; proto-oncogene c-Jun; enhancer-binding protein AP1; Jun activation domain binding protein; v-jun sarcoma virus 17 oncogene homolog; v-jun avian sarcoma virus 17 oncogene homolog; AP1; AP-1; c-Jun |
| Gene ID | 3725 |
| mRNA Refseq | NM_002228 |
| Protein Refseq | NP_002219 |
| MIM | 165160 |
| UniProt ID | P05412 |
| ◆ Recombinant Proteins | ||
| JUN-1498G | Recombinant Gallus gallus JUN Protein (Full Length), N-His tagged | +Inquiry |
| JUN-3146R | Recombinant Rat JUN Protein | +Inquiry |
| JUN-792H | Recombinant Human Jun, His-tagged, 27.3 kDa (261 aa) | +Inquiry |
| Jun-5214M | Recombinant Mouse Jun protein, His-tagged | +Inquiry |
| JUN-8438M | Recombinant Mouse JUN Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| JUN-355HKCL | Human JUN Knockdown Cell Lysate | +Inquiry |
| JUN-5095HCL | Recombinant Human JUN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JUN Products
Required fields are marked with *
My Review for All JUN Products
Required fields are marked with *
