Recombinant Human JUND Protein, GST tagged

• Cat.No.: JUND-388H
• Product Overview: Human JUND partial ORF ( NP_005345, 258 a.a. - 347 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat germ cell free in vitro.

Specification

• Species: Human
• Source: Wheat germ cell free in vitro
• Tag: GST
• Description: The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.64 kDa
• AASequence: LSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
• Applications: Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Information

• Gene Name: JUND JunD proto-oncogene, AP-1 transcription factor subunit [ Homo sapiens (human) ]
• Official Symbol: JUND
• Synonyms: JUND; JunD proto-oncogene, AP-1 transcription factor subunit; AP-1
• Gene ID: 3727
• mRNA Refseq: NM_005354
• Protein Refseq: NP_005345
• MIM: 165162
• UniProt ID: P17535