Recombinant Human JUND Protein, GST tagged
| Cat.No. : | JUND-388H |
| Product Overview : | Human JUND partial ORF ( NP_005345, 258 a.a. - 347 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat germ cell free in vitro. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat germ cell free in vitro |
| Tag : | GST |
| Description : | The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 35.64 kDa |
| AASequence : | LSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Quality Control Testing : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Gene Name | JUND JunD proto-oncogene, AP-1 transcription factor subunit [ Homo sapiens (human) ] |
| Official Symbol | JUND |
| Synonyms | JUND; JunD proto-oncogene, AP-1 transcription factor subunit; AP-1; |
| Gene ID | 3727 |
| mRNA Refseq | NM_005354 |
| Protein Refseq | NP_005345 |
| MIM | 165162 |
| UniProt ID | P17535 |
| ◆ Recombinant Proteins | ||
| JUND-1233H | Recombinant Human JUND Protein, His (Fc)-Avi-tagged | +Inquiry |
| JUND-240H | Recombinant Human JUND Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| JUND-3188H | Recombinant Human JUND Protein, His (Fc)-Avi-tagged | +Inquiry |
| Jund-1254M | Recombinant Mouse Jund Protein, MYC/DDK-tagged | +Inquiry |
| JUND-312H | Recombinant Human JUND | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| JUND-217HKCL | Human JUND Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JUND Products
Required fields are marked with *
My Review for All JUND Products
Required fields are marked with *



