Recombinant Human JUND Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | JUND-240H |
Product Overview : | JUND MS Standard C13 and N15-labeled recombinant protein (NP_005345) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms (PMID:12105216). [provided by RefSeq, Nov 2013] |
Molecular Mass : | 35 kDa |
AA Sequence : | METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | JUND jun D proto-oncogene [ Homo sapiens (human) ] |
Official Symbol | JUND |
Synonyms | JUND; jun D proto-oncogene; transcription factor jun-D; activator protein 1; AP 1; JunD FL isoform; transcription factor jun D; JunD-FL isoform; AP-1; |
Gene ID | 3727 |
mRNA Refseq | NM_005354 |
Protein Refseq | NP_005345 |
MIM | 165162 |
UniProt ID | P17535 |
◆ Recombinant Proteins | ||
JUND-785H | Recombinant Human JUND Protein, MYC/DDK-tagged | +Inquiry |
JUND-240H | Recombinant Human JUND Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
JUND-4695M | Recombinant Mouse JUND Protein, His (Fc)-Avi-tagged | +Inquiry |
JUND-2804R | Recombinant Rat JUND Protein, His (Fc)-Avi-tagged | +Inquiry |
JUND-3148R | Recombinant Rat JUND Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JUND Products
Required fields are marked with *
My Review for All JUND Products
Required fields are marked with *
0
Inquiry Basket