Recombinant Human KAT6B Protein, GST-tagged
Cat.No. : | KAT6B-5867H |
Product Overview : | Human MYST4 partial ORF ( NP_036462, 80 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a histone acetyltransferase and component of the MOZ/MORF protein complex. In addition to its acetyltransferase activity, the encoded protein has transcriptional activation activity in its N-terminal end and transcriptional repression activity in its C-terminal end. This protein is necessary for RUNX2-dependent transcriptional activation and could be involved in brain development. Mutations have been found in patients with genitopatellar syndrome. A translocation of this gene and the CREBBP gene results in acute myeloid leukemias. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012] |
Molecular Mass : | 35.97 kDa |
AA Sequence : | FSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEEPNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KAT6B lysine acetyltransferase 6B [ Homo sapiens (human) ] |
Official Symbol | KAT6B |
Synonyms | KAT6B; lysine acetyltransferase 6B; qkf; MORF; MOZ2; GTPTS; MYST4; ZC2HC6B; querkopf; histone acetyltransferase KAT6B; K(lysine) acetyltransferase 6B; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 4; MOZ-related factor; MYST histone acetyltransferase (monocytic leukemia) 4; MYST-4; histone acetyltransferase MORF; histone acetyltransferase MOZ2; histone acetyltransferase MYST4; monocytic leukemia zinc finger protein-related factor; EC 2.3.1.48 |
Gene ID | 23522 |
mRNA Refseq | NM_001256468 |
Protein Refseq | NP_001243397 |
MIM | 605880 |
UniProt ID | Q8WYB5 |
◆ Recombinant Proteins | ||
KAT6B-5867H | Recombinant Human KAT6B Protein, GST-tagged | +Inquiry |
KAT6B-6955H | Recombinant Human KAT6B , GST-tagged | +Inquiry |
KAT6B-1600H | Recombinant Human K(Lysine) Acetyltransferase 6B, GST-tagged | +Inquiry |
KAT6B-29889TH | Recombinant Human KAT6B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KAT6B Products
Required fields are marked with *
My Review for All KAT6B Products
Required fields are marked with *