Recombinant Human KAT6B Protein, GST-tagged

Cat.No. : KAT6B-5867H
Product Overview : Human MYST4 partial ORF ( NP_036462, 80 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a histone acetyltransferase and component of the MOZ/MORF protein complex. In addition to its acetyltransferase activity, the encoded protein has transcriptional activation activity in its N-terminal end and transcriptional repression activity in its C-terminal end. This protein is necessary for RUNX2-dependent transcriptional activation and could be involved in brain development. Mutations have been found in patients with genitopatellar syndrome. A translocation of this gene and the CREBBP gene results in acute myeloid leukemias. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012]
Molecular Mass : 35.97 kDa
AA Sequence : FSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEEPNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KAT6B lysine acetyltransferase 6B [ Homo sapiens (human) ]
Official Symbol KAT6B
Synonyms KAT6B; lysine acetyltransferase 6B; qkf; MORF; MOZ2; GTPTS; MYST4; ZC2HC6B; querkopf; histone acetyltransferase KAT6B; K(lysine) acetyltransferase 6B; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 4; MOZ-related factor; MYST histone acetyltransferase (monocytic leukemia) 4; MYST-4; histone acetyltransferase MORF; histone acetyltransferase MOZ2; histone acetyltransferase MYST4; monocytic leukemia zinc finger protein-related factor; EC 2.3.1.48
Gene ID 23522
mRNA Refseq NM_001256468
Protein Refseq NP_001243397
MIM 605880
UniProt ID Q8WYB5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KAT6B Products

Required fields are marked with *

My Review for All KAT6B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon