Recombinant Human KCNA7 protein, GST-tagged
Cat.No. : | KCNA7-301232H |
Product Overview : | Recombinant Human KCNA7 (410-456 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Ala410-Val456 |
AA Sequence : | AGMFSHVDTQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name : | KCNA7 potassium voltage-gated channel, shaker-related subfamily, member 7 [ Homo sapiens ] |
Official Symbol : | KCNA7 |
Synonyms : | KCNA7; potassium voltage-gated channel, shaker-related subfamily, member 7; potassium voltage-gated channel subfamily A member 7; HAK6; Kv1.7; voltage-gated potassium channel KCNA7; voltage-dependent potassium channel Kv1.7; voltage-gated potassium channel subunit Kv1.7; KV1.7; |
Gene ID : | 3743 |
mRNA Refseq : | NM_031886 |
Protein Refseq : | NP_114092 |
MIM : | 176268 |
UniProt ID : | Q96RP8 |
Products Types
◆ Recombinant Protein | ||
KCNA7-4720M | Recombinant Mouse KCNA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNA7-8477M | Recombinant Mouse KCNA7 Protein | +Inquiry |
◆ Lysates | ||
KCNA7-5076HCL | Recombinant Human KCNA7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All KCNA7 Products
Required fields are marked with *
My Review for All KCNA7 Products
Required fields are marked with *
0
Inquiry Basket