Recombinant Human KCNA7 protein, GST-tagged
Cat.No. : | KCNA7-301232H |
Product Overview : | Recombinant Human KCNA7 (410-456 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ala410-Val456 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | AGMFSHVDTQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KCNA7 potassium voltage-gated channel, shaker-related subfamily, member 7 [ Homo sapiens ] |
Official Symbol | KCNA7 |
Synonyms | KCNA7; potassium voltage-gated channel, shaker-related subfamily, member 7; potassium voltage-gated channel subfamily A member 7; HAK6; Kv1.7; voltage-gated potassium channel KCNA7; voltage-dependent potassium channel Kv1.7; voltage-gated potassium channel subunit Kv1.7; KV1.7; |
Gene ID | 3743 |
mRNA Refseq | NM_031886 |
Protein Refseq | NP_114092 |
MIM | 176268 |
UniProt ID | Q96RP8 |
◆ Cell & Tissue Lysates | ||
KCNA7-5076HCL | Recombinant Human KCNA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNA7 Products
Required fields are marked with *
My Review for All KCNA7 Products
Required fields are marked with *