Recombinant Human KCND1 Protein (410-647 aa), His-tagged KCND1-1429H

Specification
Gene Information
Related Products

Cat.No. :	KCND1-1429H
Product Overview :	Recombinant Human KCND1 Protein (410-647 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.
Description :	Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
Source :	Yeast
Species :	Human
Tag :	His
Form :	Tris-based buffer,50% glycerol
Molecular Mass :	27.7 kDa
Protein length :	410-647 aa
AA Sequence :	NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
Purity :	> 90% as determined by SDS-PAGE.
Notes :	Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage :	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration :	A hardcopy of COA with reconstitution instruction is sent along with the products.
Figure :	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Download Datasheet

Gene Name :	KCND1 potassium voltage-gated channel, Shal-related subfamily, member 1 [ Homo sapiens ]
Official Symbol :	KCND1
Synonyms :	KCND1; Kv4.1; KV4.1;
Gene ID :	3750
mRNA Refseq :	NM_004979
Protein Refseq :	NP_004970
MIM :	300281
UniProt ID :	Q9NSA2