Recombinant Human KCND2 protein, His-tagged
Cat.No. : | KCND2-3249H |
Product Overview : | Recombinant Human KCND2 protein(435-630 aa), fused to His tag, was expressed in E. coli. |
Availability | May 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 435-630 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KCND2 potassium voltage-gated channel, Shal-related subfamily, member 2 [ Homo sapiens ] |
Official Symbol | KCND2 |
Synonyms | KCND2; potassium voltage-gated channel, Shal-related subfamily, member 2; potassium voltage-gated channel subfamily D member 2; KIAA1044; Kv4.2; RK5; voltage-sensitive potassium channel; voltage-gated potassium channel Kv4.2; voltage-gated potassium channel subunit Kv4.2; KV4.2; MGC119702; MGC119703; |
Gene ID | 3751 |
mRNA Refseq | NM_012281 |
Protein Refseq | NP_036413 |
MIM | 605410 |
UniProt ID | Q9NZV8 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCND2 Products
Required fields are marked with *
My Review for All KCND2 Products
Required fields are marked with *
0
Inquiry Basket