Recombinant Human KCND2 protein, His-tagged

Cat.No. : KCND2-3249H
Product Overview : Recombinant Human KCND2 protein(435-630 aa), fused to His tag, was expressed in E. coli.
Availability July 04, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 435-630 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : AAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name KCND2 potassium voltage-gated channel, Shal-related subfamily, member 2 [ Homo sapiens ]
Official Symbol KCND2
Synonyms KCND2; potassium voltage-gated channel, Shal-related subfamily, member 2; potassium voltage-gated channel subfamily D member 2; KIAA1044; Kv4.2; RK5; voltage-sensitive potassium channel; voltage-gated potassium channel Kv4.2; voltage-gated potassium channel subunit Kv4.2; KV4.2; MGC119702; MGC119703;
Gene ID 3751
mRNA Refseq NM_012281
Protein Refseq NP_036413
MIM 605410
UniProt ID Q9NZV8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCND2 Products

Required fields are marked with *

My Review for All KCND2 Products

Required fields are marked with *

0
cart-icon