Recombinant Human KCND2 protein, His-tagged
| Cat.No. : | KCND2-3249H |
| Product Overview : | Recombinant Human KCND2 protein(435-630 aa), fused to His tag, was expressed in E. coli. |
| Availability | June 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 435-630 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | KCND2 potassium voltage-gated channel, Shal-related subfamily, member 2 [ Homo sapiens ] |
| Official Symbol | KCND2 |
| Synonyms | KCND2; potassium voltage-gated channel, Shal-related subfamily, member 2; potassium voltage-gated channel subfamily D member 2; KIAA1044; Kv4.2; RK5; voltage-sensitive potassium channel; voltage-gated potassium channel Kv4.2; voltage-gated potassium channel subunit Kv4.2; KV4.2; MGC119702; MGC119703; |
| Gene ID | 3751 |
| mRNA Refseq | NM_012281 |
| Protein Refseq | NP_036413 |
| MIM | 605410 |
| UniProt ID | Q9NZV8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCND2 Products
Required fields are marked with *
My Review for All KCND2 Products
Required fields are marked with *
