Recombinant Human KCNE2 Full Length Transmembrane protein, His-tagged
| Cat.No. : | KCNE2-240H |
| Product Overview : | Recombinant Human KCNE2 protein, fused to His-tag, was expressed in E.coli and purified by Ni-sepharose. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-123aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.3 kDa |
| AA Sequence : | MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | KCNE2 potassium voltage-gated channel, Isk-related family, member 2 [ Homo sapiens ] |
| Official Symbol | KCNE2 |
| Synonyms | KCNE2; potassium voltage-gated channel, Isk-related family, member 2; potassium voltage-gated channel subfamily E member 2; MiRP1; minK-related peptide 1; minK-related peptide-1; potassium channel subunit, MiRP1; potassium channel subunit beta MiRP1; voltage-gated K+ channel subunit MIRP1; minimum potassium ion channel-related peptide 1; cardiac voltage-gated potassium channel accessory subunit 2; LQT5; LQT6; ATFB4; MIRP1; MGC138292; |
| Gene ID | 9992 |
| mRNA Refseq | NM_172201 |
| Protein Refseq | NP_751951 |
| MIM | 603796 |
| UniProt ID | Q9Y6J6 |
| ◆ Recombinant Proteins | ||
| KCNE2-4728M | Recombinant Mouse KCNE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL36210RF | Recombinant Full Length Rat Potassium Voltage-Gated Channel Subfamily E Member 2(Kcne2) Protein, His-Tagged | +Inquiry |
| Kcne2-3655M | Recombinant Mouse Kcne2 Protein, Myc/DDK-tagged | +Inquiry |
| KCNE2-2834R | Recombinant Rat KCNE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Kcne2-3130R | Recombinant Rat Kcne2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KCNE2-5065HCL | Recombinant Human KCNE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNE2 Products
Required fields are marked with *
My Review for All KCNE2 Products
Required fields are marked with *
