Recombinant Human KCNE2 Full Length Transmembrane protein, His-tagged
Cat.No. : | KCNE2-240H |
Product Overview : | Recombinant Human KCNE2 protein, fused to His-tag, was expressed in E.coli and purified by Ni-sepharose. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-123aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | KCNE2 potassium voltage-gated channel, Isk-related family, member 2 [ Homo sapiens ] |
Official Symbol | KCNE2 |
Synonyms | KCNE2; potassium voltage-gated channel, Isk-related family, member 2; potassium voltage-gated channel subfamily E member 2; MiRP1; minK-related peptide 1; minK-related peptide-1; potassium channel subunit, MiRP1; potassium channel subunit beta MiRP1; voltage-gated K+ channel subunit MIRP1; minimum potassium ion channel-related peptide 1; cardiac voltage-gated potassium channel accessory subunit 2; LQT5; LQT6; ATFB4; MIRP1; MGC138292; |
Gene ID | 9992 |
mRNA Refseq | NM_172201 |
Protein Refseq | NP_751951 |
MIM | 603796 |
UniProt ID | Q9Y6J6 |
◆ Recombinant Proteins | ||
KCNE2-3178R | Recombinant Rat KCNE2 Protein | +Inquiry |
KCNE2-240H | Recombinant Human KCNE2 Full Length Transmembrane protein, His-tagged | +Inquiry |
KCNE2-4728M | Recombinant Mouse KCNE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Kcne2-3655M | Recombinant Mouse Kcne2 Protein, Myc/DDK-tagged | +Inquiry |
KCNE2-2834R | Recombinant Rat KCNE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNE2-5065HCL | Recombinant Human KCNE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNE2 Products
Required fields are marked with *
My Review for All KCNE2 Products
Required fields are marked with *
0
Inquiry Basket