Recombinant Human KCNE2 Full Length Transmembrane protein, His-tagged

Cat.No. : KCNE2-240H
Product Overview : Recombinant Human KCNE2 protein, fused to His-tag, was expressed in E.coli and purified by Ni-sepharose.
Availability August 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-123aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.3 kDa
AA Sequence : MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name KCNE2 potassium voltage-gated channel, Isk-related family, member 2 [ Homo sapiens ]
Official Symbol KCNE2
Synonyms KCNE2; potassium voltage-gated channel, Isk-related family, member 2; potassium voltage-gated channel subfamily E member 2; MiRP1; minK-related peptide 1; minK-related peptide-1; potassium channel subunit, MiRP1; potassium channel subunit beta MiRP1; voltage-gated K+ channel subunit MIRP1; minimum potassium ion channel-related peptide 1; cardiac voltage-gated potassium channel accessory subunit 2; LQT5; LQT6; ATFB4; MIRP1; MGC138292;
Gene ID 9992
mRNA Refseq NM_172201
Protein Refseq NP_751951
MIM 603796
UniProt ID Q9Y6J6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNE2 Products

Required fields are marked with *

My Review for All KCNE2 Products

Required fields are marked with *

0
cart-icon