Recombinant Human KCNIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : KCNIP2-4884H
Product Overview : KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_055406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
Molecular Mass : 32.3 kDa
AA Sequence : MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSEIGRVFRFLGDSSLPSALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name KCNIP2 Kv channel interacting protein 2 [ Homo sapiens (human) ]
Official Symbol KCNIP2
Synonyms KCNIP2; Kv channel interacting protein 2; Kv channel-interacting protein 2; KCHIP2; potassium channel-interacting protein 2; A-type potassium channel modulatory protein 2; cardiac voltage-gated potassium channel modulatory subunit; MGC17241; DKFZp566L1246;
Gene ID 30819
mRNA Refseq NM_014591
Protein Refseq NP_055406
MIM 604661
UniProt ID Q9NS61

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNIP2 Products

Required fields are marked with *

My Review for All KCNIP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon