Recombinant Human KCNIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KCNIP2-6730H
• Product Overview: KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_775283) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
• Molecular Mass: 30.7 kDa
• AA Sequence: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KCNIP2 Kv channel interacting protein 2 [ Homo sapiens (human) ]
• Official Symbol: KCNIP2
• Synonyms: KCNIP2; Kv channel interacting protein 2; Kv channel-interacting protein 2; KCHIP2; potassium channel-interacting protein 2; A-type potassium channel modulatory protein 2; cardiac voltage-gated potassium channel modulatory subunit; MGC17241; DKFZp566L1246
• Gene ID: 30819
• mRNA Refseq: NM_173191
• Protein Refseq: NP_775283
• MIM: 604661
• UniProt ID: Q9NS61