Recombinant Human KCNIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | KCNIP2-6730H |
| Product Overview : | KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_775283) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. |
| Molecular Mass : | 30.7 kDa |
| AA Sequence : | MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | KCNIP2 Kv channel interacting protein 2 [ Homo sapiens (human) ] |
| Official Symbol | KCNIP2 |
| Synonyms | KCNIP2; Kv channel interacting protein 2; Kv channel-interacting protein 2; KCHIP2; potassium channel-interacting protein 2; A-type potassium channel modulatory protein 2; cardiac voltage-gated potassium channel modulatory subunit; MGC17241; DKFZp566L1246; |
| Gene ID | 30819 |
| mRNA Refseq | NM_173191 |
| Protein Refseq | NP_775283 |
| MIM | 604661 |
| UniProt ID | Q9NS61 |
| ◆ Recombinant Proteins | ||
| KCNIP2-4884H | Recombinant Human KCNIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KCNIP2-2176R | Recombinant Rhesus Macaque KCNIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KCNIP2-1678H | Recombinant Human KCNIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KCNIP2-5823C | Recombinant Chicken KCNIP2 | +Inquiry |
| KCNIP2-250H | Recombinant Human KCNIP2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KCNIP2-5055HCL | Recombinant Human KCNIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNIP2 Products
Required fields are marked with *
My Review for All KCNIP2 Products
Required fields are marked with *
