Recombinant Human KCNJ10 Full Length Transmembrane protein, His-tagged

Cat.No. : KCNJ10-351H
Product Overview : Recombinant Human KCNJ10 protein(P78508)(1-379aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-379aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 48.6 kDa
AA Sequence : MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name KCNJ10 potassium inwardly-rectifying channel, subfamily J, member 10 [ Homo sapiens ]
Official Symbol KCNJ10
Synonyms KCNJ10; potassium inwardly-rectifying channel, subfamily J, member 10; ATP-sensitive inward rectifier potassium channel 10; Kir1.2; Kir4.1; inward rectifier K+ channel KIR1.2; inward rectifier K(+) channel Kir1.2; ATP-dependent inwardly rectifying potassium channel Kir4.1; potassium channel, inwardly rectifying subfamily J member 10; glial ATP-dependent inwardly rectifying potassium channel KIR4.1; KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN;
Gene ID 3766
mRNA Refseq NM_002241
Protein Refseq NP_002232
MIM 602208
UniProt ID P78508

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNJ10 Products

Required fields are marked with *

My Review for All KCNJ10 Products

Required fields are marked with *

0
cart-icon