Recombinant Human KCNJ10 Full Length Transmembrane protein, His-tagged
| Cat.No. : | KCNJ10-351H |
| Product Overview : | Recombinant Human KCNJ10 protein(P78508)(1-379aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-379aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.6 kDa |
| AA Sequence : | MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | KCNJ10 potassium inwardly-rectifying channel, subfamily J, member 10 [ Homo sapiens ] |
| Official Symbol | KCNJ10 |
| Synonyms | KCNJ10; potassium inwardly-rectifying channel, subfamily J, member 10; ATP-sensitive inward rectifier potassium channel 10; Kir1.2; Kir4.1; inward rectifier K+ channel KIR1.2; inward rectifier K(+) channel Kir1.2; ATP-dependent inwardly rectifying potassium channel Kir4.1; potassium channel, inwardly rectifying subfamily J member 10; glial ATP-dependent inwardly rectifying potassium channel KIR4.1; KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN; |
| Gene ID | 3766 |
| mRNA Refseq | NM_002241 |
| Protein Refseq | NP_002232 |
| MIM | 602208 |
| UniProt ID | P78508 |
| ◆ Recombinant Proteins | ||
| KCNJ10-3195R | Recombinant Rat KCNJ10 Protein | +Inquiry |
| Kcnj10-6271R | Recombinant Rat Kcnj10 Full Length Transmembrane protein, His-tagged | +Inquiry |
| KCNJ10-2544H | Recombinant Human KCNJ10 protein, His-tagged | +Inquiry |
| KCNJ10-351H | Recombinant Human KCNJ10 Full Length Transmembrane protein, His-tagged | +Inquiry |
| KCNJ10-2357R | Recombinant Rhesus monkey KCNJ10 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNJ10 Products
Required fields are marked with *
My Review for All KCNJ10 Products
Required fields are marked with *
