Recombinant Human KCNJ11

Cat.No. : KCNJ11-29900TH
Product Overview : Recombinant fragment corresponding to amino acids 301-390 of Human Kir6.2 with an N terminal proprietary tag; Predicted MWt 35.53 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins and is found associated with the sulfonylurea receptor SUR. Mutations in this gene are a cause of familial persistent hyperinsulinemic hypoglycemia of infancy (PHHI), an autosomal recessive disorder characterized by unregulated insulin secretion. Defects in this gene may also contribute to autosomal dominant non-insulin-dependent diabetes mellitus type II (NIDDM), transient neonatal diabetes mellitus type 3 (TNDM3), and permanent neonatal diabetes mellitus (PNDM). Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
Gene Name KCNJ11 potassium inwardly-rectifying channel, subfamily J, member 11 [ Homo sapiens ]
Official Symbol KCNJ11
Synonyms KCNJ11; potassium inwardly-rectifying channel, subfamily J, member 11; ATP-sensitive inward rectifier potassium channel 11; BIR; Kir6.2;
Gene ID 3767
mRNA Refseq NM_000525
Protein Refseq NP_000516
MIM 600937
Uniprot ID Q14654
Chromosome Location 11p15.1
Pathway ATP sensitive Potassium channels, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Inwardly rectifying K+ channels, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function ATP binding; ATP-activated inward rectifier potassium channel activity; inward rectifier potassium channel activity; potassium ion binding; protein C-terminus binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNJ11 Products

Required fields are marked with *

My Review for All KCNJ11 Products

Required fields are marked with *

0
cart-icon