Recombinant Human KCNK13 protein, His-tagged
Cat.No. : | KCNK13-4013H |
Product Overview : | Recombinant Human KCNK13 protein(286-338 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | July 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 286-338 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | SLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | KCNK13 potassium channel, subfamily K, member 13 [ Homo sapiens ] |
Official Symbol | KCNK13 |
Synonyms | KCNK13; potassium channel, subfamily K, member 13; potassium channel subfamily K member 13; K2p13.1; THIK 1; THIK1; K2P13.1 potassium channel; tandem pore domain potassium channel THIK-1; tandem pore domain halothane-inhibited potassium channel 1; THIK-1; |
Gene ID | 56659 |
mRNA Refseq | NM_022054 |
Protein Refseq | NP_071337 |
MIM | 607367 |
UniProt ID | Q9HB14 |
◆ Cell & Tissue Lysates | ||
KCNK13-89HCL | Recombinant Human KCNK13 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNK13 Products
Required fields are marked with *
My Review for All KCNK13 Products
Required fields are marked with *