Recombinant Human KCNK13 protein, His-tagged
| Cat.No. : | KCNK13-4013H |
| Product Overview : | Recombinant Human KCNK13 protein(286-338 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 286-338 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | SLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | KCNK13 potassium channel, subfamily K, member 13 [ Homo sapiens ] |
| Official Symbol | KCNK13 |
| Synonyms | KCNK13; potassium channel, subfamily K, member 13; potassium channel subfamily K member 13; K2p13.1; THIK 1; THIK1; K2P13.1 potassium channel; tandem pore domain potassium channel THIK-1; tandem pore domain halothane-inhibited potassium channel 1; THIK-1; |
| Gene ID | 56659 |
| mRNA Refseq | NM_022054 |
| Protein Refseq | NP_071337 |
| MIM | 607367 |
| UniProt ID | Q9HB14 |
| ◆ Recombinant Proteins | ||
| KCNK13-2865R | Recombinant Rat KCNK13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KCNK13-2363R | Recombinant Rhesus monkey KCNK13 Protein, His-tagged | +Inquiry |
| KCNK13-4013H | Recombinant Human KCNK13 protein, His-tagged | +Inquiry |
| RFL12856HF | Recombinant Full Length Human Potassium Channel Subfamily K Member 13(Kcnk13) Protein, His-Tagged | +Inquiry |
| KCNK13-1211H | Recombinant Human KCNK13 Full Length Transmembrane protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KCNK13-89HCL | Recombinant Human KCNK13 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNK13 Products
Required fields are marked with *
My Review for All KCNK13 Products
Required fields are marked with *
