Recombinant Human KCNK13 protein, His-tagged
Cat.No. : | KCNK13-4013H |
Product Overview : | Recombinant Human KCNK13 protein(286-338 aa), fused to His tag, was expressed in E. coli. |
Availability | June 27, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 286-338 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KCNK13 potassium channel, subfamily K, member 13 [ Homo sapiens ] |
Official Symbol | KCNK13 |
Synonyms | KCNK13; potassium channel, subfamily K, member 13; potassium channel subfamily K member 13; K2p13.1; THIK 1; THIK1; K2P13.1 potassium channel; tandem pore domain potassium channel THIK-1; tandem pore domain halothane-inhibited potassium channel 1; THIK-1; |
Gene ID | 56659 |
mRNA Refseq | NM_022054 |
Protein Refseq | NP_071337 |
MIM | 607367 |
UniProt ID | Q9HB14 |
◆ Recombinant Proteins | ||
RFL12856HF | Recombinant Full Length Human Potassium Channel Subfamily K Member 13(Kcnk13) Protein, His-Tagged | +Inquiry |
RFL2627RF | Recombinant Full Length Rat Potassium Channel Subfamily K Member 13(Kcnk13) Protein, His-Tagged | +Inquiry |
KCNK13-2184R | Recombinant Rhesus Macaque KCNK13 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNK13-4013H | Recombinant Human KCNK13 protein, His-tagged | +Inquiry |
KCNK13-3209R | Recombinant Rat KCNK13 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK13-89HCL | Recombinant Human KCNK13 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNK13 Products
Required fields are marked with *
My Review for All KCNK13 Products
Required fields are marked with *